(data stored in ACNUC9435 zone)

EMBL: BX936399.PE59

BX936399.PE59        Location/Qualifiers
FT   CDS             complement(40503..40943)
FT                   /transl_table=11
FT                   /locus_tag="pYV0059"
FT                   /product="lcrR; hypothetical protein lcrR"
FT                   /note="similar to Y. pestis YPCD1.33c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25402"
FT                   /db_xref="InterPro:IPR013405"
FT                   /db_xref="InterPro:IPR022797"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69960"
FT                   /protein_id="CAF25402.1"
FT                   /translation="MMADPLIPWLTEHGLVCHPHTLSGTPISLGSAFQLAGLKLAWRVE
FT                   IEQRRVWIVLIQRVEQRRGLKNPFAALYMLANAARAVLGPDYYLYGNVDVLAGSSLSTQ
FT                   RLAHFYRRWTGAKELSTGWFSLKVSQVITLSNMKKRQNNGFA"
     MMADPLIPWL TEHGLVCHPH TLSGTPISLG SAFQLAGLKL AWRVEIEQRR VWIVLIQRVE        60
     QRRGLKNPFA ALYMLANAAR AVLGPDYYLY GNVDVLAGSS LSTQRLAHFY RRWTGAKELS       120
     TGWFSLKVSQ VITLSNMKKR QNNGFA                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page