(data stored in ACNUC9435 zone)

EMBL: BX936399.PE60

BX936399.PE60        Location/Qualifiers
FT   CDS             complement(40940..43054)
FT                   /transl_table=11
FT                   /locus_tag="pYV0060"
FT                   /product="lcrD, yscV; putative membrane-bound Yop protein"
FT                   /note="similar to Y. pestis YPCD1.34c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25403"
FT                   /db_xref="GOA:P69956"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006302"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69956"
FT                   /protein_id="CAF25403.1"
FT                   /translation="MNPHDLEWLNRIGERKDIMLAVLLLAVVFMMVLPLPPLVLDILIA
FT                   VNMTISVVLLMIAIYINSPLQFSAFPAVLLVTTLFRLALSVSTTRMILLQADAGQIVYT
FT                   FGNFVVGGNLIVGIVIFLIITIVQFLVITKGSERVAEVSARFSLDAMPGKQMSIDGDMR
FT                   AGVIDVNEARERRATIEKESQMFGSMDGAMKFVKGDAIAGLIIIFVNILGGVTIGVTQK
FT                   GLAAAEALQLYSILTVGDGMVSQVPALLIAITAGIIVTRVSSEDSSDLGSDIGKQVVAQ
FT                   PKAMLIGGVLLLLFGLIPGFPTVTFLILALLVGCGGYMLSRKQSRNDEANQDLQSILTS
FT                   GSGAPAARTKAKTSGANKGRLGEQEAFAMTVPLLIDVDSSQQEALEAIALNDELVRVRR
FT                   ALYLDLGVPFPGIHLRFNEGMGEGEYIISLQEVPVARGELKAGYLLVRESVSQLELLGI
FT                   PYEKGEHLLPDQEAFWVSVEYEERLEKSQLEFFSHSQVLTWHLSHVLREYAEDFIGIQE
FT                   TRYLLEQMEGGYGELIKEVQRIVPLQRMTEILQRLVGEDISIRNMRSILEAMVEWGQKE
FT                   KDVVQLTEYIRSSLKRYICYKYANGNNILPAYLFDQEVEEKIRSGVRQTSAGSYLALEP
FT                   AVTESLLEQVRKTIGDLSQIQSKPVLIVSMDIRRYVRKLIESEYYGLPVLSYQELTQQI
FT                   NIQPLGRICL"
     MNPHDLEWLN RIGERKDIML AVLLLAVVFM MVLPLPPLVL DILIAVNMTI SVVLLMIAIY        60
     INSPLQFSAF PAVLLVTTLF RLALSVSTTR MILLQADAGQ IVYTFGNFVV GGNLIVGIVI       120
     FLIITIVQFL VITKGSERVA EVSARFSLDA MPGKQMSIDG DMRAGVIDVN EARERRATIE       180
     KESQMFGSMD GAMKFVKGDA IAGLIIIFVN ILGGVTIGVT QKGLAAAEAL QLYSILTVGD       240
     GMVSQVPALL IAITAGIIVT RVSSEDSSDL GSDIGKQVVA QPKAMLIGGV LLLLFGLIPG       300
     FPTVTFLILA LLVGCGGYML SRKQSRNDEA NQDLQSILTS GSGAPAARTK AKTSGANKGR       360
     LGEQEAFAMT VPLLIDVDSS QQEALEAIAL NDELVRVRRA LYLDLGVPFP GIHLRFNEGM       420
     GEGEYIISLQ EVPVARGELK AGYLLVRESV SQLELLGIPY EKGEHLLPDQ EAFWVSVEYE       480
     ERLEKSQLEF FSHSQVLTWH LSHVLREYAE DFIGIQETRY LLEQMEGGYG ELIKEVQRIV       540
     PLQRMTEILQ RLVGEDISIR NMRSILEAMV EWGQKEKDVV QLTEYIRSSL KRYICYKYAN       600
     GNNILPAYLF DQEVEEKIRS GVRQTSAGSY LALEPAVTES LLEQVRKTIG DLSQIQSKPV       660
     LIVSMDIRRY VRKLIESEYY GLPVLSYQEL TQQINIQPLG RICL                        704
//

If you have problems or comments...

PBIL Back to PBIL home page