(data stored in ACNUC9435 zone)

EMBL: BX936399.PE61

BX936399.PE61        Location/Qualifiers
FT   CDS             complement(43041..43385)
FT                   /transl_table=11
FT                   /locus_tag="pYV0061"
FT                   /product="yscY; putative type III secretion protein"
FT                   /note="similar to Y. pestis YPCD1.35c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25404"
FT                   /db_xref="GOA:Q663K5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016684"
FT                   /db_xref="UniProtKB/TrEMBL:Q663K5"
FT                   /protein_id="CAF25404.1"
FT                   /translation="MNITLTKRQQEFLLLNGWLQLQCGHAERACILLDALLTLNPEHLA
FT                   GRRCRLVALLNNNQGERAEKEAQWLISHDPLQAGNWLCLSRAQQLNGDLDKARHAYQHY
FT                   LELKDHNESP"
     MNITLTKRQQ EFLLLNGWLQ LQCGHAERAC ILLDALLTLN PEHLAGRRCR LVALLNNNQG        60
     ERAEKEAQWL ISHDPLQAGN WLCLSRAQQL NGDLDKARHA YQHYLELKDH NESP             114
//

If you have problems or comments...

PBIL Back to PBIL home page