(data stored in ACNUC9435 zone)

EMBL: BX936399.PE62

BX936399.PE62        Location/Qualifiers
FT   CDS             complement(43382..43750)
FT                   /transl_table=11
FT                   /locus_tag="pYV0062"
FT                   /product="yscX; putative type III secretion protein"
FT                   /note="similar to Y. pestis YPCD1.36c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25405"
FT                   /db_xref="InterPro:IPR012672"
FT                   /db_xref="UniProtKB/TrEMBL:Q663K4"
FT                   /protein_id="CAF25405.1"
FT                   /translation="MSRIITAPHIGIEKLSAISLEELSCGLPERYALPPDGHPVEPHLE
FT                   RLYPTAQSKRSLWDFASPGYTFHGLHRAQDYRRELDTLQSLLTTSQSSELQAAAALLKC
FT                   QQDDDRLLQIILNLLHKV"
     MSRIITAPHI GIEKLSAISL EELSCGLPER YALPPDGHPV EPHLERLYPT AQSKRSLWDF        60
     ASPGYTFHGL HRAQDYRREL DTLQSLLTTS QSSELQAAAA LLKCQQDDDR LLQIILNLLH       120
     KV                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page