(data stored in ACNUC9435 zone)

EMBL: BX936399.PE63

BX936399.PE63        Location/Qualifiers
FT   CDS             complement(43747..44118)
FT                   /transl_table=11
FT                   /locus_tag="pYV0063"
FT                   /product="sycN; putative type III secretion protein"
FT                   /note="similar to Y. pestis YPCD1.37c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25406"
FT                   /db_xref="GOA:P61381"
FT                   /db_xref="InterPro:IPR012673"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61381"
FT                   /protein_id="CAF25406.1"
FT                   /translation="MSWIEPIISHFCQDLGVPTSSPLSPLIQLEMAQSGTLQLEQHGAT
FT                   LTLWLARSLAWHRCEDAMVKALTLTAAQKSGALPLRAGWLGESQLVLFVSLDERSLTLP
FT                   LLHQAFEQLLRLQQEVLAP"
     MSWIEPIISH FCQDLGVPTS SPLSPLIQLE MAQSGTLQLE QHGATLTLWL ARSLAWHRCE        60
     DAMVKALTLT AAQKSGALPL RAGWLGESQL VLFVSLDERS LTLPLLHQAF EQLLRLQQEV       120
     LAP                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page