(data stored in ACNUC9435 zone)

EMBL: BX936399.PE64

BX936399.PE64        Location/Qualifiers
FT   CDS             complement(44105..44383)
FT                   /transl_table=11
FT                   /locus_tag="pYV0064"
FT                   /product="tyeA; putative Yop secretion and targeting
FT                   protein"
FT                   /note="similar to Y. pestis YPCD1.38c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25407"
FT                   /db_xref="InterPro:IPR013351"
FT                   /db_xref="InterPro:IPR015144"
FT                   /db_xref="InterPro:IPR038347"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69969"
FT                   /protein_id="CAF25407.1"
FT                   /translation="MAYDLSEFMGDIVALVDKRWAGIHDIEHLANAFSLPTPEIKVRFY
FT                   QDLKRMFRLFPLGVFSDEEQRQNLLQMCQNAIDMAIESEEEELSELD"
     MAYDLSEFMG DIVALVDKRW AGIHDIEHLA NAFSLPTPEI KVRFYQDLKR MFRLFPLGVF        60
     SDEEQRQNLL QMCQNAIDMA IESEEEELSE LD                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page