(data stored in ACNUC9435 zone)

EMBL: BX936399.PE65

BX936399.PE65        Location/Qualifiers
FT   CDS             complement(44364..45245)
FT                   /transl_table=11
FT                   /locus_tag="pYV0065"
FT                   /product="yopN, lcrE; putative membrane-bound Yop targeting
FT                   protein"
FT                   /note="similar to Y. pestis YPCD1.39c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25408"
FT                   /db_xref="GOA:Q663K1"
FT                   /db_xref="InterPro:IPR010812"
FT                   /db_xref="InterPro:IPR013401"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q663K1"
FT                   /protein_id="CAF25408.1"
FT                   /translation="MTTLHNLSYGNTPLHNERPEIASSQIVNQTLGQFRGESVQIVSGT
FT                   LQSIADMAEEVTFVFSERKELSLDKRKLSDSQARVSDVEEQVNQYLSKVPELEQKQNVS
FT                   ELLSLLSNSPNISLSQLKAYLEGKSEEPSEQFKMLCGLRDALKGRPELAHLSHLVEQAL
FT                   VSMAEEQGETIVLGARITPEAYRESQSGVNPLQPLRDTYRDAVMGYQGIYAIWSDLQKR
FT                   FPNGDIDSVILFLQKALSADLQSQQSGSGREKLGIVINDLQKLKEFGSVSDQVKGFWQF
FT                   FSEGKTNGVRPF"
     MTTLHNLSYG NTPLHNERPE IASSQIVNQT LGQFRGESVQ IVSGTLQSIA DMAEEVTFVF        60
     SERKELSLDK RKLSDSQARV SDVEEQVNQY LSKVPELEQK QNVSELLSLL SNSPNISLSQ       120
     LKAYLEGKSE EPSEQFKMLC GLRDALKGRP ELAHLSHLVE QALVSMAEEQ GETIVLGARI       180
     TPEAYRESQS GVNPLQPLRD TYRDAVMGYQ GIYAIWSDLQ KRFPNGDIDS VILFLQKALS       240
     ADLQSQQSGS GREKLGIVIN DLQKLKEFGS VSDQVKGFWQ FFSEGKTNGV RPF              293
//

If you have problems or comments...

PBIL Back to PBIL home page