(data stored in ACNUC9435 zone)

EMBL: BX936399.PE68

BX936399.PE68        Location/Qualifiers
FT   CDS             46759..47223
FT                   /transl_table=11
FT                   /locus_tag="pYV0068"
FT                   /product="yscO; putative type III secretion protein"
FT                   /note="identical to Y. pestis YPCD1.41"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25411"
FT                   /db_xref="GOA:P40294"
FT                   /db_xref="InterPro:IPR009929"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40294"
FT                   /protein_id="CAF25411.1"
FT                   /translation="MIRRLHRVKVLRVERAEKAIKTQQACLQAAHRRHQEAVQTSQDYH
FT                   LWRIDEEQRLFDQRKNTTLNCKDLEKWQRQIASLREKEANYELECAKLLERLANERERL
FT                   TLCQKMLQQARHKENKFLELVRREDEDELNQQHYQEEQEQEEFLQHHRNA"
     MIRRLHRVKV LRVERAEKAI KTQQACLQAA HRRHQEAVQT SQDYHLWRID EEQRLFDQRK        60
     NTTLNCKDLE KWQRQIASLR EKEANYELEC AKLLERLANE RERLTLCQKM LQQARHKENK       120
     FLELVRREDE DELNQQHYQE EQEQEEFLQH HRNA                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page