(data stored in ACNUC9435 zone)

EMBL: BX936399.PE69

BX936399.PE69        Location/Qualifiers
FT   CDS             47223..48590
FT                   /transl_table=11
FT                   /locus_tag="pYV0069"
FT                   /product="yscP; putative type III secretion protein"
FT                   /note="similar to Y. pestis YPCD1.42"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25412"
FT                   /db_xref="GOA:Q663J7"
FT                   /db_xref="InterPro:IPR013354"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q663J7"
FT                   /protein_id="CAF25412.2"
FT                   /translation="MNKITTRSPLEPEYQPLGKPHHALQACVDFEQALLHNNKGNCHPK
FT                   EESLKPVRPHDLGKKEGQKGDGLRAHAPLAATSQPGRKEVGLKPQHNHQNNHDFNLSPL
FT                   AEGATNRAHLYQQDSRFDDRVESIINALMPLAPFLEGVTCETGTSSESPCEPSGHDELF
FT                   VQQSPIDSAQPVQLNTKPTVQPLNPAADGAEVIVWSVGRETPASIAKNQRDSRQKRLAE
FT                   EPLALHQKALPEICPPAVSATPDDHLVARWCATPVTEVAEKSARFPYKATVQSEQLDMT
FT                   ELADRSQHLTDGVDSSKDTIEPPRPEELLLPREETLPEMYSLSFTAPVVTPGDHLLATM
FT                   RATRLASVSEQLIQLAQRLAVELELRGGSSQVTQLHLNLPELGAIMVRIAEIPGKLHVE
FT                   LIASREALRILAQGSYDLLERLQRIEPTQLDFQASDDSEQESRQKRHVYEEWEAEE"
     MNKITTRSPL EPEYQPLGKP HHALQACVDF EQALLHNNKG NCHPKEESLK PVRPHDLGKK        60
     EGQKGDGLRA HAPLAATSQP GRKEVGLKPQ HNHQNNHDFN LSPLAEGATN RAHLYQQDSR       120
     FDDRVESIIN ALMPLAPFLE GVTCETGTSS ESPCEPSGHD ELFVQQSPID SAQPVQLNTK       180
     PTVQPLNPAA DGAEVIVWSV GRETPASIAK NQRDSRQKRL AEEPLALHQK ALPEICPPAV       240
     SATPDDHLVA RWCATPVTEV AEKSARFPYK ATVQSEQLDM TELADRSQHL TDGVDSSKDT       300
     IEPPRPEELL LPREETLPEM YSLSFTAPVV TPGDHLLATM RATRLASVSE QLIQLAQRLA       360
     VELELRGGSS QVTQLHLNLP ELGAIMVRIA EIPGKLHVEL IASREALRIL AQGSYDLLER       420
     LQRIEPTQLD FQASDDSEQE SRQKRHVYEE WEAEE                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page