(data stored in ACNUC9435 zone)

EMBL: BX936399.PE70

BX936399.PE70        Location/Qualifiers
FT   CDS             48587..49510
FT                   /transl_table=11
FT                   /locus_tag="pYV0070"
FT                   /product="yscQ; putative type III secretion protein"
FT                   /note="identical to Y. pestis YPCD1.43"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25413"
FT                   /db_xref="GOA:P40296"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR003283"
FT                   /db_xref="InterPro:IPR013385"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="PDB:3UEP"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40296"
FT                   /protein_id="CAF25413.1"
FT                   /translation="MSLLTLPQAKLSELSLRQRLSHYQQNYLWEEGKLELTVSEPPSSL
FT                   NCILQLQWKGTHFTLYCFGNDLANWLTADLLGAPFFTLPKELQLALLERQTVFLPKLVC
FT                   NDIATASLSVTQPLLSLRLSRDNAHISFWLTSAEALFALLPARPNSERIPLPILISLRW
FT                   HKVYLTLDEVDSLRLGDVLLAPEGSGPNSPVLAYVGENPWGYFQLQSNKLEFIGMSHES
FT                   DELNPEPLTDLNQLPVQVSFEVGRQILDWHTLTSLEPGSLIDLTTPVDGEVRLLANGRL
FT                   LGHGRLVEIQGRLGVRIERLTEVTIS"
     MSLLTLPQAK LSELSLRQRL SHYQQNYLWE EGKLELTVSE PPSSLNCILQ LQWKGTHFTL        60
     YCFGNDLANW LTADLLGAPF FTLPKELQLA LLERQTVFLP KLVCNDIATA SLSVTQPLLS       120
     LRLSRDNAHI SFWLTSAEAL FALLPARPNS ERIPLPILIS LRWHKVYLTL DEVDSLRLGD       180
     VLLAPEGSGP NSPVLAYVGE NPWGYFQLQS NKLEFIGMSH ESDELNPEPL TDLNQLPVQV       240
     SFEVGRQILD WHTLTSLEPG SLIDLTTPVD GEVRLLANGR LLGHGRLVEI QGRLGVRIER       300
     LTEVTIS                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page