(data stored in ACNUC9435 zone)

EMBL: BX936399.PE71

BX936399.PE71        Location/Qualifiers
FT   CDS             49507..50160
FT                   /transl_table=11
FT                   /locus_tag="pYV0071"
FT                   /product="yscR; putative Yop secretion membrane protein"
FT                   /note="identical to Y. pestis YPCD1.44"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25414"
FT                   /db_xref="GOA:P69981"
FT                   /db_xref="InterPro:IPR005773"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69981"
FT                   /protein_id="CAF25414.1"
FT                   /translation="MIQLPDEINLIIVLSLLTLLPLISVMATSFVKFAVVFSLLRNALG
FT                   VQQIPPNMAMYGLAIILSLYVMAPVGFATQDYLQANEVSLTNIESVEKFFDEGLAPYRM
FT                   FLKQHIQAQEYSFFVDSTKQLWPKQYADRLESDSLFILLPAFTVSELTRAFEIGFLIYL
FT                   PFIVIDLVISNILLAMGMMMVSPMTISLPFKLLLFVLLDGWTRLTHGLVISYGG"
     MIQLPDEINL IIVLSLLTLL PLISVMATSF VKFAVVFSLL RNALGVQQIP PNMAMYGLAI        60
     ILSLYVMAPV GFATQDYLQA NEVSLTNIES VEKFFDEGLA PYRMFLKQHI QAQEYSFFVD       120
     STKQLWPKQY ADRLESDSLF ILLPAFTVSE LTRAFEIGFL IYLPFIVIDL VISNILLAMG       180
     MMMVSPMTIS LPFKLLLFVL LDGWTRLTHG LVISYGG                                217
//

If you have problems or comments...

PBIL Back to PBIL home page