(data stored in ACNUC9435 zone)

EMBL: BX936399.PE72

BX936399.PE72        Location/Qualifiers
FT   CDS             50162..50428
FT                   /transl_table=11
FT                   /locus_tag="pYV0072"
FT                   /product="yscS; putative type III secretion protein"
FT                   /note="identical to Y. pestis YPCD1.45"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25415"
FT                   /db_xref="GOA:P69983"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006306"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69983"
FT                   /protein_id="CAF25415.1"
FT                   /translation="MSQGDIIHFTSQALWLVLVLSMPPVLVAAVVGTLVSLVQALTQIQ
FT                   EQTLGFVIKLIAVVVTLFATASWLGNELHSFAEMTMMKIQGIR"
     MSQGDIIHFT SQALWLVLVL SMPPVLVAAV VGTLVSLVQA LTQIQEQTLG FVIKLIAVVV        60
     TLFATASWLG NELHSFAEMT MMKIQGIR                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page