(data stored in ACNUC9435 zone)

EMBL: BX936399.PE73

BX936399.PE73        Location/Qualifiers
FT   CDS             50425..51210
FT                   /transl_table=11
FT                   /locus_tag="pYV0073"
FT                   /product="yscT; putative type III secretion protein"
FT                   /note="identical to Y. pestis YPCD1.46"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25416"
FT                   /db_xref="GOA:P69985"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006304"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69985"
FT                   /protein_id="CAF25416.1"
FT                   /translation="MIADLIQRPLLTYTLLLPRFMACFVILPVLSKQLLGGVLLRNGIV
FT                   CSLALYVYPAVANQPYIEVDAFTLMLLIGKEIILGLLIGFVATIPFWALESAGFIVDNQ
FT                   RGAAMASLLNPGLDSQTSPTGLLLTQTLITIFFSGGAFLSLLSALFHSYVNWPVASFFP
FT                   AVSEQWVDFFYNQFSQILLIAAVLAAPLLIAMFLAEFGLALISRFAPSLNVFVLAMPIK
FT                   SAIASLLLVIYCMQMMSHASKAMLLVMDPISLLIPVLEK"
     MIADLIQRPL LTYTLLLPRF MACFVILPVL SKQLLGGVLL RNGIVCSLAL YVYPAVANQP        60
     YIEVDAFTLM LLIGKEIILG LLIGFVATIP FWALESAGFI VDNQRGAAMA SLLNPGLDSQ       120
     TSPTGLLLTQ TLITIFFSGG AFLSLLSALF HSYVNWPVAS FFPAVSEQWV DFFYNQFSQI       180
     LLIAAVLAAP LLIAMFLAEF GLALISRFAP SLNVFVLAMP IKSAIASLLL VIYCMQMMSH       240
     ASKAMLLVMD PISLLIPVLE K                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page