(data stored in ACNUC9435 zone)

EMBL: BX936399.PE74

BX936399.PE74        Location/Qualifiers
FT   CDS             51210..52274
FT                   /transl_table=11
FT                   /locus_tag="pYV0074"
FT                   /product="yscU; putative type III secretion protein"
FT                   /note="identical to Y. pestis YPCD1.47"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25417"
FT                   /db_xref="GOA:P69987"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006307"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="PDB:2ML9"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69987"
FT                   /protein_id="CAF25417.1"
FT                   /translation="MSGEKTEQPTPKKIRDARKKGQVAKSKEVVSTALIVALSAMLMGL
FT                   SDYYFEHFSKLMLIPAEQSYLPFSQALSYVVDNVLLEFFYLCFPLLTVAALMAIASHVV
FT                   QYGFLISGEAIKPDIKKINPIEGAKRIFSIKSLVEFLKSILKVVLLSILIWIIIKGNLV
FT                   TLLQLPTCGIECITPLLGQILRQLMVICTVGFVVISIADYAFEYYQYIKELKMSKDEIK
FT                   REYKEMEGSPEIKSKRRQFHQEIQSRNMRENVKRSSVVVANPTHIAIGILYKRGETPLP
FT                   LVTFKYTDAQVQTVRKIAEEEGVPILQRIPLARALYWDALVDHYIPAEQIEATAEVLRW
FT                   LERQNIEKQHSEML"
     MSGEKTEQPT PKKIRDARKK GQVAKSKEVV STALIVALSA MLMGLSDYYF EHFSKLMLIP        60
     AEQSYLPFSQ ALSYVVDNVL LEFFYLCFPL LTVAALMAIA SHVVQYGFLI SGEAIKPDIK       120
     KINPIEGAKR IFSIKSLVEF LKSILKVVLL SILIWIIIKG NLVTLLQLPT CGIECITPLL       180
     GQILRQLMVI CTVGFVVISI ADYAFEYYQY IKELKMSKDE IKREYKEMEG SPEIKSKRRQ       240
     FHQEIQSRNM RENVKRSSVV VANPTHIAIG ILYKRGETPL PLVTFKYTDA QVQTVRKIAE       300
     EEGVPILQRI PLARALYWDA LVDHYIPAEQ IEATAEVLRW LERQNIEKQH SEML             354
//

If you have problems or comments...

PBIL Back to PBIL home page