(data stored in ACNUC9435 zone)

EMBL: BX936399.PE78

BX936399.PE78        Location/Qualifiers
FT   CDS             54587..55000
FT                   /transl_table=11
FT                   /locus_tag="pYV0078"
FT                   /product="hypothetical protein"
FT                   /note="identical to Y. pestis YPCD1.51"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25421"
FT                   /db_xref="GOA:Q663I8"
FT                   /db_xref="InterPro:IPR010261"
FT                   /db_xref="InterPro:IPR013353"
FT                   /db_xref="UniProtKB/TrEMBL:Q663I8"
FT                   /protein_id="CAF25421.1"
FT                   /translation="MQNLLKNLAASLGRKPFVADKQGVYRLTIDKHLVMLAPHGSELVL
FT                   RTPIDAPMLREGNNVNVTLLRSLMQQALAWAKRYPQTLVLDDCGQLVLEARLRLQELDT
FT                   HGLQEVINKQLALLEHLIPQLTPFSVASRVGWN"
     MQNLLKNLAA SLGRKPFVAD KQGVYRLTID KHLVMLAPHG SELVLRTPID APMLREGNNV        60
     NVTLLRSLMQ QALAWAKRYP QTLVLDDCGQ LVLEARLRLQ ELDTHGLQEV INKQLALLEH       120
     LIPQLTPFSV ASRVGWN                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page