(data stored in ACNUC9435 zone)

EMBL: BX936399.PE79

BX936399.PE79        Location/Qualifiers
FT   CDS             55006..56829
FT                   /transl_table=11
FT                   /locus_tag="pYV0079"
FT                   /product="yscC; putative type III secretion protein"
FT                   /note="similar to Y. pestis YPCD1.52"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25422"
FT                   /db_xref="GOA:Q663I7"
FT                   /db_xref="InterPro:IPR003522"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q663I7"
FT                   /protein_id="CAF25422.1"
FT                   /translation="MAFPLHSFFKRVLTGTLLLLSNYSWAQELDWLPIPYVYVAKGESL
FT                   RDLLIDFSANYDATVVVSDKINDKVSGQFEHDNPQDFLQHIASLYNLVWYYDGNVLYIF
FT                   KNSEVASRLIRLQESEAAELKLALQRSGIWEPRFGWRPDASNRLVYVSGPPRYLELVEQ
FT                   TAAALEQQTQIRSEKTGALAIEIFPLKYASASDRTIHYRDDEVAAPGVATILQRVLSDA
FT                   TIQQVTVDNQRIPQAATRASAQAKVEADPSLNAIIVRDSPERMPMYQRLIHALDKPSAR
FT                   IEVALSIVDINADQLTELGVDWRVGIRTGNNHQVVIKTTGDQSNIASNGALGSLIDARG
FT                   LDYLLARVNLLENEGSAQVVSRPTLLTQENAQAVIDHHETYYVKVTGKEVAELKGITYG
FT                   TMLRMTPRVLTQGDKSEISLNLHIEDGNQKPNSSGIDGIPTISRTVVDTVARVGHGQSL
FT                   IIGGIYRDELSVALSKVPLLGDIPYLGALFRRKSELTRRTVRLFIIEPRIIDEGIAHHL
FT                   ALGNGRDLRTGILAVDEISNQSTTLNKLLGVSQCQPLNKAQEVQKWLSQNNKSSYLTQC
FT                   KMDKSLGWRVVEGACTPAESWCVSAPKRGVL"
     MAFPLHSFFK RVLTGTLLLL SNYSWAQELD WLPIPYVYVA KGESLRDLLI DFSANYDATV        60
     VVSDKINDKV SGQFEHDNPQ DFLQHIASLY NLVWYYDGNV LYIFKNSEVA SRLIRLQESE       120
     AAELKLALQR SGIWEPRFGW RPDASNRLVY VSGPPRYLEL VEQTAAALEQ QTQIRSEKTG       180
     ALAIEIFPLK YASASDRTIH YRDDEVAAPG VATILQRVLS DATIQQVTVD NQRIPQAATR       240
     ASAQAKVEAD PSLNAIIVRD SPERMPMYQR LIHALDKPSA RIEVALSIVD INADQLTELG       300
     VDWRVGIRTG NNHQVVIKTT GDQSNIASNG ALGSLIDARG LDYLLARVNL LENEGSAQVV       360
     SRPTLLTQEN AQAVIDHHET YYVKVTGKEV AELKGITYGT MLRMTPRVLT QGDKSEISLN       420
     LHIEDGNQKP NSSGIDGIPT ISRTVVDTVA RVGHGQSLII GGIYRDELSV ALSKVPLLGD       480
     IPYLGALFRR KSELTRRTVR LFIIEPRIID EGIAHHLALG NGRDLRTGIL AVDEISNQST       540
     TLNKLLGVSQ CQPLNKAQEV QKWLSQNNKS SYLTQCKMDK SLGWRVVEGA CTPAESWCVS       600
     APKRGVL                                                                 607
//

If you have problems or comments...

PBIL Back to PBIL home page