(data stored in ACNUC9435 zone)

EMBL: BX936399.PE80

BX936399.PE80        Location/Qualifiers
FT   CDS             56826..58085
FT                   /transl_table=11
FT                   /locus_tag="pYV0080"
FT                   /product="yscD; putative type III secretion protein"
FT                   /note="similar to Y. pestis YPCD1.53"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25423"
FT                   /db_xref="GOA:Q663I6"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR012843"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="InterPro:IPR032034"
FT                   /db_xref="PDB:4D9V"
FT                   /db_xref="UniProtKB/TrEMBL:Q663I6"
FT                   /protein_id="CAF25423.1"
FT                   /translation="MSWVCRFYQGKHRGVEVELPHGRCVFGSDPLQSDIVLSDSEIAPV
FT                   HLVLMVDEEGIRLTDSAEPLLQEGLPVPLGTLLRAGSCLEVGFLLWTFVAVGQPLPETL
FT                   QVPTQRKEPTDRLPRSRLGIGLGVLSLLLLLTFLGLLGHGLWREYNQDGQLVEQEVRRL
FT                   LATAAYKDVVLTSPKKEGEPWLLTGYIQDNHARLSLQNFLESHGIPFRLELRSMEELRQ
FT                   GAEFILQRLGYHGIEVSLAPQAGWLQLNGEVSEEIQKQKIDSLLQAEVPGLLGVESKVR
FT                   IAGNQRKRLDALLEQFGLDSDFTVNVKGELIELRGQVNDEKLNSFNQLQQTFRQEFGNR
FT                   PKLELVNVGGQPQHDELNFEVQAISLGKVPYVVLDNHQRYPEGAILNNGVRILAIRRDA
FT                   VIVSKGKREFVIQLNGGKPR"
     MSWVCRFYQG KHRGVEVELP HGRCVFGSDP LQSDIVLSDS EIAPVHLVLM VDEEGIRLTD        60
     SAEPLLQEGL PVPLGTLLRA GSCLEVGFLL WTFVAVGQPL PETLQVPTQR KEPTDRLPRS       120
     RLGIGLGVLS LLLLLTFLGL LGHGLWREYN QDGQLVEQEV RRLLATAAYK DVVLTSPKKE       180
     GEPWLLTGYI QDNHARLSLQ NFLESHGIPF RLELRSMEEL RQGAEFILQR LGYHGIEVSL       240
     APQAGWLQLN GEVSEEIQKQ KIDSLLQAEV PGLLGVESKV RIAGNQRKRL DALLEQFGLD       300
     SDFTVNVKGE LIELRGQVND EKLNSFNQLQ QTFRQEFGNR PKLELVNVGG QPQHDELNFE       360
     VQAISLGKVP YVVLDNHQRY PEGAILNNGV RILAIRRDAV IVSKGKREFV IQLNGGKPR        419
//

If you have problems or comments...

PBIL Back to PBIL home page