(data stored in ACNUC9435 zone)

EMBL: BX936399.PE81

BX936399.PE81        Location/Qualifiers
FT   CDS             58082..58282
FT                   /transl_table=11
FT                   /locus_tag="pYV0081"
FT                   /product="yscE; putative type III secretion protein"
FT                   /note="similar to Y. pestis YPCD1.54"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25424"
FT                   /db_xref="GOA:Q663I5"
FT                   /db_xref="InterPro:IPR012671"
FT                   /db_xref="UniProtKB/TrEMBL:Q663I5"
FT                   /protein_id="CAF25424.1"
FT                   /translation="MTQLEEQLHNVETVRSITMQLEMALTKLKKDMMRGGDAKQYQVWQ
FT                   RESKALESAIAIIHYVAGDLK"
     MTQLEEQLHN VETVRSITMQ LEMALTKLKK DMMRGGDAKQ YQVWQRESKA LESAIAIIHY        60
     VAGDLK                                                                   66
//

If you have problems or comments...

PBIL Back to PBIL home page