(data stored in ACNUC9435 zone)

EMBL: BX936399.PE82

BX936399.PE82        Location/Qualifiers
FT   CDS             58283..58546
FT                   /transl_table=11
FT                   /locus_tag="pYV0082"
FT                   /product="yscF; putative type III secretion protein"
FT                   /note="identical to Y. pestis YPCD1.55"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25425"
FT                   /db_xref="GOA:Q663I4"
FT                   /db_xref="InterPro:IPR011841"
FT                   /db_xref="InterPro:IPR021123"
FT                   /db_xref="InterPro:IPR037203"
FT                   /db_xref="UniProtKB/TrEMBL:Q663I4"
FT                   /protein_id="CAF25425.1"
FT                   /translation="MSNFSGFTKGTDIADLDAVAQTLKKPADDANKAVNDSIAALKDKP
FT                   DNPALLADLQHSINKWSVIYNINSTIVRSMKDLMQGILQKFP"
     MSNFSGFTKG TDIADLDAVA QTLKKPADDA NKAVNDSIAA LKDKPDNPAL LADLQHSINK        60
     WSVIYNINST IVRSMKDLMQ GILQKFP                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page