(data stored in ACNUC9435 zone)

EMBL: BX936399.PE83

BX936399.PE83        Location/Qualifiers
FT   CDS             58548..58895
FT                   /transl_table=11
FT                   /locus_tag="pYV0083"
FT                   /product="yscG; putative type III secretion protein"
FT                   /note="similar to Y. pestis YPCD1.56"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25426"
FT                   /db_xref="GOA:Q663I3"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013348"
FT                   /db_xref="UniProtKB/TrEMBL:Q663I3"
FT                   /protein_id="CAF25426.1"
FT                   /translation="MKYKLNVLLAEIALIGTGNHCHEEANCIAEWLHLKGEEEAVQLIR
FT                   LSSLMNRGDYASALQQGNKLAYPDLEPWLALCEYRLGLGSALESRLNRLARSQDPRIQT
FT                   FVNGMREQLKT"
     MKYKLNVLLA EIALIGTGNH CHEEANCIAE WLHLKGEEEA VQLIRLSSLM NRGDYASALQ        60
     QGNKLAYPDL EPWLALCEYR LGLGSALESR LNRLARSQDP RIQTFVNGMR EQLKT            115
//

If you have problems or comments...

PBIL Back to PBIL home page