(data stored in ACNUC9435 zone)

EMBL: BX936399.PE84

BX936399.PE84        Location/Qualifiers
FT   CDS             58892..59389
FT                   /transl_table=11
FT                   /locus_tag="pYV0084"
FT                   /product="yscH, yopR, lcrP; putative type III secretion
FT                   protein"
FT                   /note="similar to Y. pestis YPCD1.57"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25427"
FT                   /db_xref="GOA:Q663I2"
FT                   /db_xref="InterPro:IPR013349"
FT                   /db_xref="InterPro:IPR041814"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q663I2"
FT                   /protein_id="CAF25427.1"
FT                   /translation="MTVTLNRGSITSLMSSSQAVSTLQPVASELKTQLENKLKSESAEK
FT                   TREVLWQQYYASNPPDHAVLEVLAMPVREALLARFGQHQGSVVPAIDLPELRSVLQQFD
FT                   SFGKRWEAILLQVLEGIKPNESQVGLPYLSELINKELMILLPSNSIVDSLLHNSHQIDM
FT                   DT"
     MTVTLNRGSI TSLMSSSQAV STLQPVASEL KTQLENKLKS ESAEKTREVL WQQYYASNPP        60
     DHAVLEVLAM PVREALLARF GQHQGSVVPA IDLPELRSVL QQFDSFGKRW EAILLQVLEG       120
     IKPNESQVGL PYLSELINKE LMILLPSNSI VDSLLHNSHQ IDMDT                       165
//

If you have problems or comments...

PBIL Back to PBIL home page