(data stored in ACNUC9435 zone)

EMBL: BX936399.PE85

BX936399.PE85        Location/Qualifiers
FT   CDS             59390..59737
FT                   /transl_table=11
FT                   /locus_tag="pYV0085"
FT                   /product="yscI, lcrO; putative type III secretion protein"
FT                   /note="identical to Y. pestis YPCD1.58"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25428"
FT                   /db_xref="GOA:P69971"
FT                   /db_xref="InterPro:IPR012670"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69971"
FT                   /protein_id="CAF25428.1"
FT                   /translation="MPNIEIAQADEVIITTLEELGPAEPTTDQIMRFDAAMSEDTQGLG
FT                   HSLLKEVSDIQKSFKTVKSDLHTKLAVSVDNPNDLMLMQWSLIRITIQEELIAKTAGRM
FT                   SQNVETLSKGG"
     MPNIEIAQAD EVIITTLEEL GPAEPTTDQI MRFDAAMSED TQGLGHSLLK EVSDIQKSFK        60
     TVKSDLHTKL AVSVDNPNDL MLMQWSLIRI TIQEELIAKT AGRMSQNVET LSKGG            115
//

If you have problems or comments...

PBIL Back to PBIL home page