(data stored in ACNUC9435 zone)

EMBL: BX936399.PE87

BX936399.PE87        Location/Qualifiers
FT   CDS             60457..61107
FT                   /transl_table=11
FT                   /locus_tag="pYV0087"
FT                   /product="yscK; putative type III secretion protein"
FT                   /note="identical to Y. pestis YPCD1.60"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25430"
FT                   /db_xref="GOA:P69975"
FT                   /db_xref="InterPro:IPR009510"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69975"
FT                   /protein_id="CAF25430.1"
FT                   /translation="MVTTQEVMMENYITSFQLRFCPAAYLHLEQLPSLWRSILPYLPQW
FT                   RDSAHLNAALLDEFSLDTDYEEPHGLGALPLQPQSQLELLLCRLGLVLHGEAIRRCVLA
FT                   SPLQQLLTLVNQETLRQIIVQHELLIGPWPTHWQRPLPTEIESRTMIQSGLAFWLAAME
FT                   PQPQAWCKRLSLRLPLATPSEPWLVAESQRPLAQTLCHKLVKQVTPTCSHLFK"
     MVTTQEVMME NYITSFQLRF CPAAYLHLEQ LPSLWRSILP YLPQWRDSAH LNAALLDEFS        60
     LDTDYEEPHG LGALPLQPQS QLELLLCRLG LVLHGEAIRR CVLASPLQQL LTLVNQETLR       120
     QIIVQHELLI GPWPTHWQRP LPTEIESRTM IQSGLAFWLA AMEPQPQAWC KRLSLRLPLA       180
     TPSEPWLVAE SQRPLAQTLC HKLVKQVTPT CSHLFK                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page