(data stored in ACNUC9435 zone)

EMBL: BX936399.PE88

BX936399.PE88        Location/Qualifiers
FT   CDS             61086..61718
FT                   /transl_table=11
FT                   /locus_tag="pYV0088"
FT                   /product="yscL; putative type III secretion protein"
FT                   /note="similar to Y. pestis YPCD1.61"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25431"
FT                   /db_xref="GOA:P69977"
FT                   /db_xref="InterPro:IPR012842"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69977"
FT                   /protein_id="CAF25431.1"
FT                   /translation="MQPFVQIIPSNLSLACGLRILRAEDYQSSLTTEELISAAKQDAEK
FT                   ILADAQEVYEQQKQLGWQAGMDEARTLQATLIHETQLQCQQFYRHVEQQMSEVVLLAVR
FT                   KILNDYDQVAMTLQVVREALALVSNQKQVVVRVNPDQAGAIREQIAKVHKDFPEISYLE
FT                   VTADARLDQGGCILETEVGIIDASIDGQIEALSRAISTTLGQMKVTE"
     MQPFVQIIPS NLSLACGLRI LRAEDYQSSL TTEELISAAK QDAEKILADA QEVYEQQKQL        60
     GWQAGMDEAR TLQATLIHET QLQCQQFYRH VEQQMSEVVL LAVRKILNDY DQVAMTLQVV       120
     REALALVSNQ KQVVVRVNPD QAGAIREQIA KVHKDFPEIS YLEVTADARL DQGGCILETE       180
     VGIIDASIDG QIEALSRAIS TTLGQMKVTE                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page