(data stored in ACNUC9435 zone)

EMBL: BX936399.PE94

BX936399.PE94        Location/Qualifiers
FT   CDS             complement(64366..65772)
FT                   /transl_table=11
FT                   /locus_tag="pYV0094"
FT                   /product="yopH; putative protein-tyrosine phosphatase Yop
FT                   effector"
FT                   /note="similar to Y. pestis YPCD1.67c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25437"
FT                   /db_xref="GOA:P08538"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003546"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR015103"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR036484"
FT                   /db_xref="PDB:1K46"
FT                   /db_xref="PDB:1M0V"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08538"
FT                   /protein_id="CAF25437.1"
FT                   /translation="MNLSLSDLHRQVSRLVQQESGDCTGKLRGNVAANKETTFQGLTIA
FT                   SGARESEKVFAQTVLSHVANVVLTQEDTAKLLQSTVKHNLNNYDLRSVGNGNSVLVSLR
FT                   SDQMTLQDAKVLLEAALRQESGARGHVSSHSHSALHAPGTPVREGLRSHLDPRTPPLPP
FT                   RERPHTSGHHGAGEARATAPSTVSPYGPEARAELSSRLTTLRNTLAPATNDPRYLQACG
FT                   GEKLNRFRDIQCCRQTAVRADLNANYIQVGNTRTIACQYPLQSQLESHFRMLAENRTPV
FT                   LAVLASSSEIANQRFGMPDYFRQSGTYGSITVESKMTQQVGLGDGIMADMYTLTIREAG
FT                   QKTISVPVVHVGNWPDQTAVSSEVTKALASLVDQTAETKRNMYESKGSSAVGDDSKLRP
FT                   VIHCRAGVGRTAQLIGAMCMNDSRNSQLSVEDMVSQMRVQRNGIMVQKDEQLDVLIKLA
FT                   EGQGRPLLNS"
     MNLSLSDLHR QVSRLVQQES GDCTGKLRGN VAANKETTFQ GLTIASGARE SEKVFAQTVL        60
     SHVANVVLTQ EDTAKLLQST VKHNLNNYDL RSVGNGNSVL VSLRSDQMTL QDAKVLLEAA       120
     LRQESGARGH VSSHSHSALH APGTPVREGL RSHLDPRTPP LPPRERPHTS GHHGAGEARA       180
     TAPSTVSPYG PEARAELSSR LTTLRNTLAP ATNDPRYLQA CGGEKLNRFR DIQCCRQTAV       240
     RADLNANYIQ VGNTRTIACQ YPLQSQLESH FRMLAENRTP VLAVLASSSE IANQRFGMPD       300
     YFRQSGTYGS ITVESKMTQQ VGLGDGIMAD MYTLTIREAG QKTISVPVVH VGNWPDQTAV       360
     SSEVTKALAS LVDQTAETKR NMYESKGSSA VGDDSKLRPV IHCRAGVGRT AQLIGAMCMN       420
     DSRNSQLSVE DMVSQMRVQR NGIMVQKDEQ LDVLIKLAEG QGRPLLNS                    468
//

If you have problems or comments...

PBIL Back to PBIL home page