(data stored in ACNUC9435 zone)

EMBL: BX936399.PE97

BX936399.PE97        Location/Qualifiers
FT   CDS             complement(66902..66994)
FT                   /transl_table=11
FT                   /locus_tag="pYV0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25440"
FT                   /db_xref="UniProtKB/TrEMBL:Q663G9"
FT                   /protein_id="CAF25440.1"
FT                   /translation="MQNAQIRLLDIIAYERVVFSEIQLLNNCAK"
     MQNAQIRLLD IIAYERVVFS EIQLLNNCAK                                         30

If you have problems or comments...

PBIL Back to PBIL home page