(data stored in ACNUC9435 zone)

EMBL: BX936399.PE98

BX936399.PE98        Location/Qualifiers
FT   CDS             complement(67275..68141)
FT                   /transl_table=11
FT                   /locus_tag="pYV0098"
FT                   /product="yopP, yopJ; putative targeted effector protein"
FT                   /note="similar to Y. pestis YPCD1.71c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25441"
FT                   /db_xref="GOA:P31498"
FT                   /db_xref="InterPro:IPR005083"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31498"
FT                   /protein_id="CAF25441.1"
FT                   /translation="MIGPISQINISGGLSEKETSSLISNEELKNIITQLETDISDGSWF
FT                   HKNYSRMDVEVMPALVIQANNKYPEMNLNLVTSPLDLSIEIKNVIENGVRSSRFIINMG
FT                   EGGIHFSVIDYKHINGKTSLILFEPANFNSMGPAMLAIRTKTAIERYQLPDCHFSMVEM
FT                   DIQRSSSECGIFSFALAKKLYIERDSLLKIHEDNIKGILSDGENPLPHDKLDPYLPVTF
FT                   YKHTQGKKRLNEYLNTNPQGVGTVVNKKNETIVNRFDNNKSIVDGKELSVSVHKKRIAE
FT                   YKTLLKV"
     MIGPISQINI SGGLSEKETS SLISNEELKN IITQLETDIS DGSWFHKNYS RMDVEVMPAL        60
     VIQANNKYPE MNLNLVTSPL DLSIEIKNVI ENGVRSSRFI INMGEGGIHF SVIDYKHING       120
     KTSLILFEPA NFNSMGPAML AIRTKTAIER YQLPDCHFSM VEMDIQRSSS ECGIFSFALA       180
     KKLYIERDSL LKIHEDNIKG ILSDGENPLP HDKLDPYLPV TFYKHTQGKK RLNEYLNTNP       240
     QGVGTVVNKK NETIVNRFDN NKSIVDGKEL SVSVHKKRIA EYKTLLKV                    288
//

If you have problems or comments...

PBIL Back to PBIL home page