(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE10

CAGLA1_12.PE10       Location/Qualifiers
FT   CDS             39196..40284
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000024037" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195207"
FT                   /locus_tag="CAGL0M00330g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="NADP or NADPH binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="CAG62335.1"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="HOGENOM:HBG252503"
FT                   /db_xref="HOGENOM:HBG477935"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR022697"
FT                   /db_xref="UniParc:UPI00003B6FEA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK85"
FT                   /transl_table=1
FT                   /translation="MSNKSVNVAIIGTGVVGSSFLDQIVAMKSNITYNIIYVAELSKAL
FT                   ISEDYSPLALGSDWAKAVNGANQGPLALEKLVDFLKKSPIPVILVDNTSSAAIASFYPT
FT                   FVENGISIATPNKKAFSSDLATWDSLFSGKPTNGLVYHEATVGAGLPILGFLREIIQTG
FT                   DEIEKIEGIFSGTLSYIFNEFSTTTTNDVKFSDVVKVAKQLGYTEPDPRDDLNGLDVAR
FT                   KVTIVARISGVKVESPTSFPVQSLIPKPLESVESVDEFLQKLPEYDDELTQLKKEAAEE
FT                   NKVLRFIGKVDVATGKPSVGIEKYDHSHPFASLKGSDNVISIKTKRYTNPVVIQGAGAG
FT                   AAVTAAGILGDVIKAAQRLVGA"
     MSNKSVNVAI IGTGVVGSSF LDQIVAMKSN ITYNIIYVAE LSKALISEDY SPLALGSDWA        60
     KAVNGANQGP LALEKLVDFL KKSPIPVILV DNTSSAAIAS FYPTFVENGI SIATPNKKAF       120
     SSDLATWDSL FSGKPTNGLV YHEATVGAGL PILGFLREII QTGDEIEKIE GIFSGTLSYI       180
     FNEFSTTTTN DVKFSDVVKV AKQLGYTEPD PRDDLNGLDV ARKVTIVARI SGVKVESPTS       240
     FPVQSLIPKP LESVESVDEF LQKLPEYDDE LTQLKKEAAE ENKVLRFIGK VDVATGKPSV       300
     GIEKYDHSHP FASLKGSDNV ISIKTKRYTN PVVIQGAGAG AAVTAAGILG DVIKAAQRLV       360
     GA                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page