(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE100

CAGLA1_12.PE100      Location/Qualifiers
FT   CDS             278407..279219
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436729"
FT                   /gene_name="ATG5"
FT                   /locus_tag="CAGL0M02343g"
FT                   /product="Autophagy protein 5 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62424.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG190234"
FT                   /db_xref="InterPro:IPR007239"
FT                   /db_xref="UniParc:UPI00003B7041"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJZ6"
FT                   /transl_table=1
FT                   /translation="MGDSKELVWNGSINVQIKLDSRLLVDGVPEGRRLVNIRVPRESHI
FT                   AIYTPLVLERLRNVLRSDIEELLPKVWYSYKDISLPWSIPFGTLFDIYNGAHKGISGSR
FT                   DNYINVWKLNLVTDEKFPINVIPIIEGQDQLRKFMMQSWKQCCFILNGSSKRVMSLSLQ
FT                   DSLEVWEGVTERDYAKYSGVIKRILPRTPRRIPVAIHAANGGPIVQTTEPTLTDTSFSQ
FT                   AVEGIVKADFVVCQGIVMYLRDFSDTSLYDVYDKLHSIDGYLHLIANL"
     MGDSKELVWN GSINVQIKLD SRLLVDGVPE GRRLVNIRVP RESHIAIYTP LVLERLRNVL        60
     RSDIEELLPK VWYSYKDISL PWSIPFGTLF DIYNGAHKGI SGSRDNYINV WKLNLVTDEK       120
     FPINVIPIIE GQDQLRKFMM QSWKQCCFIL NGSSKRVMSL SLQDSLEVWE GVTERDYAKY       180
     SGVIKRILPR TPRRIPVAIH AANGGPIVQT TEPTLTDTSF SQAVEGIVKA DFVVCQGIVM       240
     YLRDFSDTSL YDVYDKLHSI DGYLHLIANL                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page