(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE101

CAGLA1_12.PE101      Location/Qualifiers
FT   CDS             complement(279263..279721)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000115674" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500881"
FT                   /gene_name="PPT2"
FT                   /locus_tag="CAGL0M02365g"
FT                   /product="Mitochondrial holo-[acyl-carrier-protein]
FT                   synthase"
FT                   /EC_number="2.7.8.7"
FT                   /function="holo-[acyl-carrier-protein] synthase activity "
FT                   /function="magnesium ion binding"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="macromolecule biosynthetic process "
FT                   /biological_process="protein-cofactor linkage"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAG62425.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0008897"
FT                   /db_xref="GO:0009059"
FT                   /db_xref="GO:0018065"
FT                   /db_xref="HOGENOM:HBG124027"
FT                   /db_xref="HOGENOM:HBG203879"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR016614"
FT                   /db_xref="UniParc:UPI00003B7042"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJZ5"
FT                   /transl_table=1
FT                   /translation="MSVLGVGCDVVHLPRMHRLLTKYDAGSRGFQRVVSKFMHPTERIA
FT                   LGVDGASLSAGQIRYIAGTWALKEAALKALHCAAPLHTVLPPAMFIYTKLLYRQRRSNG
FT                   VPQLLLDNEALRLDQLQFLRQAKFLSTLSHDNEYLVAYTTLIDTKNLV"
     MSVLGVGCDV VHLPRMHRLL TKYDAGSRGF QRVVSKFMHP TERIALGVDG ASLSAGQIRY        60
     IAGTWALKEA ALKALHCAAP LHTVLPPAMF IYTKLLYRQR RSNGVPQLLL DNEALRLDQL       120
     QFLRQAKFLS TLSHDNEYLV AYTTLIDTKN LV                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page