(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE102

CAGLA1_12.PE102      Location/Qualifiers
FT   CDS             280372..282942
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000206081" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044350"
FT                   /locus_tag="CAGL0M02387g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62426.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG524837"
FT                   /db_xref="HOGENOM:HBG557888"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010509"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI00003B7043"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJZ4"
FT                   /transl_table=1
FT                   /translation="MDGIRVRNVLINVHRQCIGLDIERIAGKRYLGVLLKHLYYVARTG
FT                   STGYLDGHKRRARMILLVVVLMGVAGASGISWGVMRMLTRLRGWYLHSWKNRGRRPSMR
FT                   RTRSQTRLVDGGRIIYVPEDSIDGKPTSSKKNKKFLIPPTDNDIYEHDKFLFKNVESER
FT                   TRSSQLFYSKFLNQMSVISRILIPSFLDKNAILLSSQIFFLIMRTWLSLFVARLDGQIV
FT                   KDIIAGRGRRFLLDIGCWFLIAIPASYTNSAIKYLQRKLSLSFRTNLTRYIHDMYLDKR
FT                   LGFYKLLYDSKASTSVIKNIDNSITSDVTKFSDATCSVFANIAKPVIDLVFFSVYLRDN
FT                   LGTMGVAGIFVNYFITGYILKKYTPPLGELASSKSSAEGDYYNYQLNMINNNEEIAFYQ
FT                   GTEVEKTKVKELYENLMERTLLVDKRKFTYNMVEDYILKYTWSGLGYVFASIPIVVSTV
FT                   ASGINNEEVNMKEFIVNKRLMLSLADAGSRLMHSIKDISQLTGYTNRIFTLLCVLHRVH
FT                   STDFNYGANIEDKLQEISDALSSSSTLPNKTKVDIIRGTIQRNFNGVRFENIDVIIPSP
FT                   SGREGVKLINKLAFQIPPHIDFNMSHSNSILDITGSKDVNLPFLQGPGSSLLILGPNSC
FT                   GKTSIQRIIAEIWPIYNKKGLMSIPAQENLICIPQKPYFTRGGTLRDQLIYPMSSDEFF
FT                   DRGFKDKYLVQIMSEVKLDYLLKRGTGLSYLDTVADWKDVLSGGEKQRVNFARIMFHRP
FT                   LFVVLDEATNAISADMEDYLFNLLKRYRFNFITISQRPTLIKYHDLLLEISGKSSGSWH
FT                   LQTLGTDEAINSIEHEIEELEEKLENVKLWEIERDELIRKLSVV"
     MDGIRVRNVL INVHRQCIGL DIERIAGKRY LGVLLKHLYY VARTGSTGYL DGHKRRARMI        60
     LLVVVLMGVA GASGISWGVM RMLTRLRGWY LHSWKNRGRR PSMRRTRSQT RLVDGGRIIY       120
     VPEDSIDGKP TSSKKNKKFL IPPTDNDIYE HDKFLFKNVE SERTRSSQLF YSKFLNQMSV       180
     ISRILIPSFL DKNAILLSSQ IFFLIMRTWL SLFVARLDGQ IVKDIIAGRG RRFLLDIGCW       240
     FLIAIPASYT NSAIKYLQRK LSLSFRTNLT RYIHDMYLDK RLGFYKLLYD SKASTSVIKN       300
     IDNSITSDVT KFSDATCSVF ANIAKPVIDL VFFSVYLRDN LGTMGVAGIF VNYFITGYIL       360
     KKYTPPLGEL ASSKSSAEGD YYNYQLNMIN NNEEIAFYQG TEVEKTKVKE LYENLMERTL       420
     LVDKRKFTYN MVEDYILKYT WSGLGYVFAS IPIVVSTVAS GINNEEVNMK EFIVNKRLML       480
     SLADAGSRLM HSIKDISQLT GYTNRIFTLL CVLHRVHSTD FNYGANIEDK LQEISDALSS       540
     SSTLPNKTKV DIIRGTIQRN FNGVRFENID VIIPSPSGRE GVKLINKLAF QIPPHIDFNM       600
     SHSNSILDIT GSKDVNLPFL QGPGSSLLIL GPNSCGKTSI QRIIAEIWPI YNKKGLMSIP       660
     AQENLICIPQ KPYFTRGGTL RDQLIYPMSS DEFFDRGFKD KYLVQIMSEV KLDYLLKRGT       720
     GLSYLDTVAD WKDVLSGGEK QRVNFARIMF HRPLFVVLDE ATNAISADME DYLFNLLKRY       780
     RFNFITISQR PTLIKYHDLL LEISGKSSGS WHLQTLGTDE AINSIEHEIE ELEEKLENVK       840
     LWEIERDELI RKLSVV                                                       856
//

If you have problems or comments...

PBIL Back to PBIL home page