(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE104

CAGLA1_12.PE104      Location/Qualifiers
FT   CDS             complement(285179..286495)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000197950" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436731"
FT                   /locus_tag="CAGL0M02431g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /biological_process="steroid metabolic process "
FT                   /protein_id="CAG62428.1"
FT                   /db_xref="GO:0008202"
FT                   /db_xref="HOGENOM:HBG053829"
FT                   /db_xref="HOGENOM:HBG677053"
FT                   /db_xref="InterPro:IPR000648"
FT                   /db_xref="InterPro:IPR018494"
FT                   /db_xref="UniParc:UPI00003B7045"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJZ2"
FT                   /transl_table=1
FT                   /translation="MSGYASSSAWTSFLKSVSTFNGDLSSLVAPPFILSPVSLSEFSQY
FT                   WAEHPDLFLEPSFINEANFKTKCTEDPNVESPEMARMLSVTKWFISTLKSQYCSRDETM
FT                   GSEKKPLNPFLGELFVGKWDNKDHPEFGETVLLSEQVSHHPPITAYTIFNDKNKVKLQG
FT                   YNQVKTGFTKTLMLSVKQYGHTLLEVNKESYLITPPPLHIEGILMAAPFVELEGRSYLQ
FT                   SSTGLLCVVEFSGRGYFSGKKNSFKARIYKSAADSADKNKAIYTISGQWSGSSKISKLN
FT                   PATGYSDEIGTFYEAERVPVSHLSVKPIDKQHPLESRKAWKEVAEAIKAGDMDLITKTK
FT                   SDLEQKQRDLRKEEEAKGICWERRWFKDFDYSDAPGKDYLVPEKDDIFLQLAKAMDLSI
FT                   KNVPSGTLNGEKEDKKEDLTSIHWRFDRKLWDEEKEVVL"
     MSGYASSSAW TSFLKSVSTF NGDLSSLVAP PFILSPVSLS EFSQYWAEHP DLFLEPSFIN        60
     EANFKTKCTE DPNVESPEMA RMLSVTKWFI STLKSQYCSR DETMGSEKKP LNPFLGELFV       120
     GKWDNKDHPE FGETVLLSEQ VSHHPPITAY TIFNDKNKVK LQGYNQVKTG FTKTLMLSVK       180
     QYGHTLLEVN KESYLITPPP LHIEGILMAA PFVELEGRSY LQSSTGLLCV VEFSGRGYFS       240
     GKKNSFKARI YKSAADSADK NKAIYTISGQ WSGSSKISKL NPATGYSDEI GTFYEAERVP       300
     VSHLSVKPID KQHPLESRKA WKEVAEAIKA GDMDLITKTK SDLEQKQRDL RKEEEAKGIC       360
     WERRWFKDFD YSDAPGKDYL VPEKDDIFLQ LAKAMDLSIK NVPSGTLNGE KEDKKEDLTS       420
     IHWRFDRKLW DEEKEVVL                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page