(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE106

CAGLA1_12.PE106      Location/Qualifiers
FT   CDS             join(289221..289239,290018..290322)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195636" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436732"
FT                   /locus_tag="CAGL0M02497g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG62430.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG211000"
FT                   /db_xref="HOGENOM:HBG539420"
FT                   /db_xref="InterPro:IPR001780"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR018266"
FT                   /db_xref="UniParc:UPI00003B7047"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJZ0"
FT                   /transl_table=1
FT                   /translation="MAESHRLYVKGKHLSYQRSKSVNNPNVSLLQIEGVANPQEAQFYL
FT                   GKRVAYVYRASKEVRGSKIRVMWGKITRTHGNSGVVRAKFRNNLPAKTFGASVRIFLYP
FT                   SNI"
     MAESHRLYVK GKHLSYQRSK SVNNPNVSLL QIEGVANPQE AQFYLGKRVA YVYRASKEVR        60
     GSKIRVMWGK ITRTHGNSGV VRAKFRNNLP AKTFGASVRI FLYPSNI                     107
//

If you have problems or comments...

PBIL Back to PBIL home page