(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE107

CAGLA1_12.PE107      Location/Qualifiers
FT   CDS             complement(290723..292993)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247883" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436733"
FT                   /locus_tag="CAGL0M02519g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG62432.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG203881"
FT                   /db_xref="HOGENOM:HBG252860"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020674"
FT                   /db_xref="UniParc:UPI00003B7049"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJY8"
FT                   /transl_table=1
FT                   /translation="MTASKRHTYYGGGSISYERTNNSEHDKTQRPQDHQGPKHRKHVTF
FT                   GPYVIGATLGEGEFGKVKLAWSKSAYQQCDNTEGNAGNKPMTFKVPKQVAIKLIKRDFI
FT                   TKDPSKETKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYAAGGEFYKFIQRKRR
FT                   LKENHACRLFSQLISAVHYIHSKGLVHRDLKLENLLLDNEENLIITDFGFVNEFLRQNG
FT                   MMKTSCGSPCYAAPELVVSNRPYDARKADTWSCGIILFAMLAGYLPWDDDPKNPDGHDI
FT                   SRLYNYILNTPLKFPEYINPVPRDLLRKILVIDPKKRINIRSIEKHPWLESHSTFLSIT
FT                   PDEWDRLSNTKNIYRKSKPQFYPNKRPGSTYSNYSSGSKDNKRDSLIIDSALVSLPVPP
FT                   KEFQSHILARPSSLVVESRYSPLGKRNGHNRSNSAASAALQAVFDASERESLKSVDSKP
FT                   RSRSNDHKDIIEGIQPQKHAFVKPSRKVRPTSMQAPGSSYIHHGNFEGLHELMKRDNST
FT                   ASSHQTSISSEARIFDASPTLIPDLTKSPSSSTGNSPKLLPRKSFTVSKPLLDLKFASA
FT                   DIIKANESTDSLSKRIHDQIYEVEHPRQRRHSYRYSGIISDLIFGTLSEEGEINTFENK
FT                   DHKSDAEESEMTISESKLDSVSICSQQSNIHRNISKQASSVSLLRTTSNHSTNNLNVGS
FT                   RTYGRAELYDKRHLRQIPSNTLNQINAPGNTHRNSAIYSEDDKRKSTAKRVFEFFKRRS
FT                   MRV"
     MTASKRHTYY GGGSISYERT NNSEHDKTQR PQDHQGPKHR KHVTFGPYVI GATLGEGEFG        60
     KVKLAWSKSA YQQCDNTEGN AGNKPMTFKV PKQVAIKLIK RDFITKDPSK ETKIYREINA       120
     LKHLSHPNIV KLEEVLQNSK YIGIVLEYAA GGEFYKFIQR KRRLKENHAC RLFSQLISAV       180
     HYIHSKGLVH RDLKLENLLL DNEENLIITD FGFVNEFLRQ NGMMKTSCGS PCYAAPELVV       240
     SNRPYDARKA DTWSCGIILF AMLAGYLPWD DDPKNPDGHD ISRLYNYILN TPLKFPEYIN       300
     PVPRDLLRKI LVIDPKKRIN IRSIEKHPWL ESHSTFLSIT PDEWDRLSNT KNIYRKSKPQ       360
     FYPNKRPGST YSNYSSGSKD NKRDSLIIDS ALVSLPVPPK EFQSHILARP SSLVVESRYS       420
     PLGKRNGHNR SNSAASAALQ AVFDASERES LKSVDSKPRS RSNDHKDIIE GIQPQKHAFV       480
     KPSRKVRPTS MQAPGSSYIH HGNFEGLHEL MKRDNSTASS HQTSISSEAR IFDASPTLIP       540
     DLTKSPSSST GNSPKLLPRK SFTVSKPLLD LKFASADIIK ANESTDSLSK RIHDQIYEVE       600
     HPRQRRHSYR YSGIISDLIF GTLSEEGEIN TFENKDHKSD AEESEMTISE SKLDSVSICS       660
     QQSNIHRNIS KQASSVSLLR TTSNHSTNNL NVGSRTYGRA ELYDKRHLRQ IPSNTLNQIN       720
     APGNTHRNSA IYSEDDKRKS TAKRVFEFFK RRSMRV                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page