(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE109

CAGLA1_12.PE109      Location/Qualifiers
FT   CDS             complement(295156..296529)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500882"
FT                   /locus_tag="CAGL0M02563g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62434.1"
FT                   /db_xref="HOGENOM:HBG058424"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="UniParc:UPI00003B704B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJY6"
FT                   /transl_table=1
FT                   /translation="MTVDTEIASNKLRNEEFKIWKKTIPLLYQHISTMKPKYANASKGT
FT                   IKDVPCCLTFSDEVIPNKANGTLSTVIYYGIGNEIYSLDCDLPLGLHLQKDTLQPNEKL
FT                   QLPQFDQIVSRIQSEDLSPKWRAAANCNIYKIKCVGNGKVVALLDSGAIVWFQESTESP
FT                   VSMVDGGAKIIPNKYELEEDFVNDSLNKIDFDFDLSLNGEKIIVSQAVLNEDRTVIKVF
FT                   SNIDKDLGKLLISLDLPGTKSVHNIKFYNDNIFGFCDNSGNLYFYDSRNLATPIWKIEN
FT                   EHILSFAFSPLVETLLITGGANGIINFWDVKRLTVKTATTGGDKRQESLLSLSNHVEEP
FT                   ISSVEFSASSPSEFITVGISGSIYHWDVFNYFEKVSELFSEGGDQSAIDSLDTEEIQAE
FT                   SLTFYHTGGSRRHLGKSTKKNSVSVHPIIEGLIGTIDTDGLITVYKPFTGVLPEAEDS"
     MTVDTEIASN KLRNEEFKIW KKTIPLLYQH ISTMKPKYAN ASKGTIKDVP CCLTFSDEVI        60
     PNKANGTLST VIYYGIGNEI YSLDCDLPLG LHLQKDTLQP NEKLQLPQFD QIVSRIQSED       120
     LSPKWRAAAN CNIYKIKCVG NGKVVALLDS GAIVWFQEST ESPVSMVDGG AKIIPNKYEL       180
     EEDFVNDSLN KIDFDFDLSL NGEKIIVSQA VLNEDRTVIK VFSNIDKDLG KLLISLDLPG       240
     TKSVHNIKFY NDNIFGFCDN SGNLYFYDSR NLATPIWKIE NEHILSFAFS PLVETLLITG       300
     GANGIINFWD VKRLTVKTAT TGGDKRQESL LSLSNHVEEP ISSVEFSASS PSEFITVGIS       360
     GSIYHWDVFN YFEKVSELFS EGGDQSAIDS LDTEEIQAES LTFYHTGGSR RHLGKSTKKN       420
     SVSVHPIIEG LIGTIDTDGL ITVYKPFTGV LPEAEDS                                457
//

If you have problems or comments...

PBIL Back to PBIL home page