(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE11

CAGLA1_12.PE11       Location/Qualifiers
FT   CDS             complement(40767..46181)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000093241" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435642"
FT                   /gene_name="IML1"
FT                   /locus_tag="CAGL0M00352g"
FT                   /product="Vacuolar membrane-associated protein IML1 "
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="CAG62336.1"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="HOGENOM:HBG058122"
FT                   /db_xref="HOGENOM:HBG395415"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR022046"
FT                   /db_xref="UniParc:UPI00003B6FEB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK84"
FT                   /transl_table=1
FT                   /translation="MFSALRSKNQSNKRSNDDSINSRKDVNELSLGAGGTSTSTNTNHN
FT                   DSPSIKNKNKNKNKNKTENENIYKLTISSGRSRGTASNTTNANTLVLNAGVAIVGKAPI
FT                   ASSQNEIQTISGQSLQSGIDTNLMTAGFGRSAGIDSTTTVSHDANSVKSRLQRLPTITT
FT                   SYKEINNGNKPVQVEPQDDSHYTSSLLVDTDPRSNNQPQSISSNAVANVEINRTLQLDL
FT                   VYHESRVSEKLVMLDLKKLPHIKEGQLCELRTYRKRKSTSARSNKNSRDKKLYFIAHDF
FT                   DEETRKRCHKFGNISVALGQLQLLLDLPPRSRVWIKPKRKEDTAADLIELHIKDILVNR
FT                   GDMWCMSSELVDTCVFTGQRIMFLDSIRTTVNGIYKNGKKVLSGYINDNTKIVFRSESS
FT                   RLLFIIQITNEMWSFDESGEQMFQKMINSFFPKIFNKWKDIETHHSITIAFAISMDMST
FT                   SSYKDLKPGQRIKNTTDYYRIVVDQVSVIYWVEIMESLRKEFMEITRELLSRKSDDKKD
FT                   NELSVIKGRFAPVIKSNILELINFAATTIVDPFRQLDLRHTSTHVMIISPGKGLYDVDY
FT                   DLLQLSCKKLLSLELTMDLICLSNPPLHVVPLFRYIDYENKLHHCIPPWLNIFFWNDKT
FT                   KDTNKWTPRCQIYDLQMMGLTDTELVQELELDYLNPSDDINDLQTFLKDYDRDIFLPIS
FT                   TANFKAENISSDPDEEDLKELKKINDKTTTIHKSSTSRNTLTKSQRTNSEENNSIRSRK
FT                   GDTIIKDPQFVGKISNSSRNNPPYDLSDKSTFEKQFKPKTTFHPSAMIKKTPENMKKLT
FT                   NPVFQQQYFDIQTDNGLTGNSKNLLIKNTKYLTPIIDEPQTPLVTGNLYRTRFESQSND
FT                   NELNENSKLPERGGGTDERRNVSAADTLKDVTKKSSIKDFTQRIFTKFLATTKQSNFNS
FT                   DGINSSAITEDAVLISDDTDGKTNNNNDFAVYPSSVADGDVSGDNQHRLNNKDSFTSIL
FT                   KPIPRPQLGVKIFKSDINNLSSNENVNSETKQNLLGTRNTINRKQFTASPHFTSSTKNS
FT                   VSNHSRFIKFDSMDDWIEILEDSIPSYSFLGDDLLPTRWRDVWPKNVFRKYSKWKSFTS
FT                   PAELPITLKRFPSKYELENNFMLRNHSVTQNWEQEQYKLTTKDLLRNMIYLRLLVGFQI
FT                   CTSSTIEEVESARKGDRDVFAIHKYLRGDLTGTFKIYMLMGSEIHRLHYDNSGTINVER
FT                   YIEKSERNVFDQVPSYTSFVKTRYDSNYRKTDVDPIHTKRSEFNWNLLDQLLAGYSDPY
FT                   LYDEWHGFRSKYVILPAEIPSNTFSMVVNGKNETLTTEEIRVEGLRKLIASITRLKLLS
FT                   VEESKIQKDRKTEIQPEVIFYTGSLFDFLNEQQAQLDSSTLNFKDSIFGDVTKKLNKNI
FT                   DLKNLAQELQMGENKLNLVTRKWHWKRHANCFVGSEMVNWLIRNFSDIDTRSTAISYGQ
FT                   KLMNDGLFIHVLDKHSFLDGNYFYQISPEFIINMNTVERTNSKNSNTSDNNTLKKTTSR
FT                   NSTESNLTPLSMRNKVSTMDDDSTQLANTTSANSYKEKKTVVLSNSMLINVDPSSKSYK
FT                   EELCTVHFDRVHNPEHCFHIRLEWLTTTPKLIDNMLGNWARICEKYGLKLIEIPWNELC
FT                   TIPSVDPFHTFVQLHLVINPWEDPEFNDPELFAVSKFYYHIHLLKMSGFLLDNRASRFF
FT                   QRDDADFEIMYSWGKPQFKYAQYIHTTGAYIAEMRENGNIFLAPNNVYMSRVNRANVIS
FT                   KTRSSPTFTVDSRKVVIEFSRTCYSYAKLRAVFLDAKEKWLSNKTVED"
     MFSALRSKNQ SNKRSNDDSI NSRKDVNELS LGAGGTSTST NTNHNDSPSI KNKNKNKNKN        60
     KTENENIYKL TISSGRSRGT ASNTTNANTL VLNAGVAIVG KAPIASSQNE IQTISGQSLQ       120
     SGIDTNLMTA GFGRSAGIDS TTTVSHDANS VKSRLQRLPT ITTSYKEINN GNKPVQVEPQ       180
     DDSHYTSSLL VDTDPRSNNQ PQSISSNAVA NVEINRTLQL DLVYHESRVS EKLVMLDLKK       240
     LPHIKEGQLC ELRTYRKRKS TSARSNKNSR DKKLYFIAHD FDEETRKRCH KFGNISVALG       300
     QLQLLLDLPP RSRVWIKPKR KEDTAADLIE LHIKDILVNR GDMWCMSSEL VDTCVFTGQR       360
     IMFLDSIRTT VNGIYKNGKK VLSGYINDNT KIVFRSESSR LLFIIQITNE MWSFDESGEQ       420
     MFQKMINSFF PKIFNKWKDI ETHHSITIAF AISMDMSTSS YKDLKPGQRI KNTTDYYRIV       480
     VDQVSVIYWV EIMESLRKEF MEITRELLSR KSDDKKDNEL SVIKGRFAPV IKSNILELIN       540
     FAATTIVDPF RQLDLRHTST HVMIISPGKG LYDVDYDLLQ LSCKKLLSLE LTMDLICLSN       600
     PPLHVVPLFR YIDYENKLHH CIPPWLNIFF WNDKTKDTNK WTPRCQIYDL QMMGLTDTEL       660
     VQELELDYLN PSDDINDLQT FLKDYDRDIF LPISTANFKA ENISSDPDEE DLKELKKIND       720
     KTTTIHKSST SRNTLTKSQR TNSEENNSIR SRKGDTIIKD PQFVGKISNS SRNNPPYDLS       780
     DKSTFEKQFK PKTTFHPSAM IKKTPENMKK LTNPVFQQQY FDIQTDNGLT GNSKNLLIKN       840
     TKYLTPIIDE PQTPLVTGNL YRTRFESQSN DNELNENSKL PERGGGTDER RNVSAADTLK       900
     DVTKKSSIKD FTQRIFTKFL ATTKQSNFNS DGINSSAITE DAVLISDDTD GKTNNNNDFA       960
     VYPSSVADGD VSGDNQHRLN NKDSFTSILK PIPRPQLGVK IFKSDINNLS SNENVNSETK      1020
     QNLLGTRNTI NRKQFTASPH FTSSTKNSVS NHSRFIKFDS MDDWIEILED SIPSYSFLGD      1080
     DLLPTRWRDV WPKNVFRKYS KWKSFTSPAE LPITLKRFPS KYELENNFML RNHSVTQNWE      1140
     QEQYKLTTKD LLRNMIYLRL LVGFQICTSS TIEEVESARK GDRDVFAIHK YLRGDLTGTF      1200
     KIYMLMGSEI HRLHYDNSGT INVERYIEKS ERNVFDQVPS YTSFVKTRYD SNYRKTDVDP      1260
     IHTKRSEFNW NLLDQLLAGY SDPYLYDEWH GFRSKYVILP AEIPSNTFSM VVNGKNETLT      1320
     TEEIRVEGLR KLIASITRLK LLSVEESKIQ KDRKTEIQPE VIFYTGSLFD FLNEQQAQLD      1380
     SSTLNFKDSI FGDVTKKLNK NIDLKNLAQE LQMGENKLNL VTRKWHWKRH ANCFVGSEMV      1440
     NWLIRNFSDI DTRSTAISYG QKLMNDGLFI HVLDKHSFLD GNYFYQISPE FIINMNTVER      1500
     TNSKNSNTSD NNTLKKTTSR NSTESNLTPL SMRNKVSTMD DDSTQLANTT SANSYKEKKT      1560
     VVLSNSMLIN VDPSSKSYKE ELCTVHFDRV HNPEHCFHIR LEWLTTTPKL IDNMLGNWAR      1620
     ICEKYGLKLI EIPWNELCTI PSVDPFHTFV QLHLVINPWE DPEFNDPELF AVSKFYYHIH      1680
     LLKMSGFLLD NRASRFFQRD DADFEIMYSW GKPQFKYAQY IHTTGAYIAE MRENGNIFLA      1740
     PNNVYMSRVN RANVISKTRS SPTFTVDSRK VVIEFSRTCY SYAKLRAVFL DAKEKWLSNK      1800
     TVED                                                                   1804
//

If you have problems or comments...

PBIL Back to PBIL home page