(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE113

CAGLA1_12.PE113      Location/Qualifiers
FT   CDS             complement(304583..305971)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164620" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500883"
FT                   /locus_tag="CAGL0M02651g"
FT                   /product="Similar to uniprot|P19541 Saccharomyces
FT                   cerevisiae YPL133c"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="signal transducer activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62438.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058418"
FT                   /db_xref="HOGENOM:HBG398051"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00003B704F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJY2"
FT                   /transl_table=1
FT                   /translation="MEEPAAKKQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLCV
FT                   ADENVSNIQSQYQYKNSMSPIGSTEIPNAEINIGDETRAIQGSNSSVYGTETPISSSNN
FT                   NLLLPPQPNFVSENVGSEFSSLNEFLMMLENPIPGESENTSQSNKEQERTAHSNMEDSI
FT                   ENTQEQTDNNEGIIGSVSVNQEISQDINEASSKANGTKTVNDGQGQEQDQEHNRQKLNK
FT                   QESSNSKAQSDKYDDTPTSKEQFFLTAADPSTEMNPVDRLKLVINAKLEAGLLKPYDYA
FT                   KGYARLQEYMDKYMNDTNKQRILKPLMSIRPAFRTIAKSLKDVDLVLVEESFERMLLSY
FT                   DRVFTSMSMPACLWRRTGEIYRANKEFASLVDCTVDDLRDGKLAIYELMTEESAVNFWE
FT                   KYGSIAFDKGQKAVLTSCSLRTKDGLKKRPCCFSFTIRRDRYNIPICIVGNFIPLSPTR
FT                   DHSN"
     MEEPAAKKQK KLYKSCIFCR RSHVNCDHQR PCSRCIKREI GHLCVADENV SNIQSQYQYK        60
     NSMSPIGSTE IPNAEINIGD ETRAIQGSNS SVYGTETPIS SSNNNLLLPP QPNFVSENVG       120
     SEFSSLNEFL MMLENPIPGE SENTSQSNKE QERTAHSNME DSIENTQEQT DNNEGIIGSV       180
     SVNQEISQDI NEASSKANGT KTVNDGQGQE QDQEHNRQKL NKQESSNSKA QSDKYDDTPT       240
     SKEQFFLTAA DPSTEMNPVD RLKLVINAKL EAGLLKPYDY AKGYARLQEY MDKYMNDTNK       300
     QRILKPLMSI RPAFRTIAKS LKDVDLVLVE ESFERMLLSY DRVFTSMSMP ACLWRRTGEI       360
     YRANKEFASL VDCTVDDLRD GKLAIYELMT EESAVNFWEK YGSIAFDKGQ KAVLTSCSLR       420
     TKDGLKKRPC CFSFTIRRDR YNIPICIVGN FIPLSPTRDH SN                          462
//

If you have problems or comments...

PBIL Back to PBIL home page