(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE114

CAGLA1_12.PE114      Location/Qualifiers
FT   CDS             306446..307303
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000264965" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436737"
FT                   /locus_tag="CAGL0M02673g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="copper ion binding"
FT                   /protein_id="CAG62439.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="HOGENOM:HBG175824"
FT                   /db_xref="HOGENOM:HBG525908"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="UniParc:UPI00003B7050"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJY1"
FT                   /transl_table=1
FT                   /translation="MSYTVGLRMAARRSVLRMTPLSQMRMVPRVSHRWSSNGPSSSAKS
FT                   SSNGNIDFSKLTRDEIKQLRDMKMAKDRKYKDRTVAYYFGSVAVIFLGLAYAAVPLYRA
FT                   ICARTGFGGVPITDKRKFTDDKLIPVDTGKRIRVSFTSEVSQILPWKFTPQQREVYVLP
FT                   GETALAFYKAKNNSDKDIIGMATYSITPGDAAQYFNKIQCFCFEEQKLAAGEEIDMPVF
FT                   FFIDPDFASDPSMRNIDDLILHYTFFRAHYGDGSAVSEHQPVEDVNMANAQILTPQVID
FT                   ATKD"
     MSYTVGLRMA ARRSVLRMTP LSQMRMVPRV SHRWSSNGPS SSAKSSSNGN IDFSKLTRDE        60
     IKQLRDMKMA KDRKYKDRTV AYYFGSVAVI FLGLAYAAVP LYRAICARTG FGGVPITDKR       120
     KFTDDKLIPV DTGKRIRVSF TSEVSQILPW KFTPQQREVY VLPGETALAF YKAKNNSDKD       180
     IIGMATYSIT PGDAAQYFNK IQCFCFEEQK LAAGEEIDMP VFFFIDPDFA SDPSMRNIDD       240
     LILHYTFFRA HYGDGSAVSE HQPVEDVNMA NAQILTPQVI DATKD                       285
//

If you have problems or comments...

PBIL Back to PBIL home page