(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE117

CAGLA1_12.PE117      Location/Qualifiers
FT   CDS             join(310925..310933,311165..311881)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176324" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500885"
FT                   /locus_tag="CAGL0M02739g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62442.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG055834"
FT                   /db_xref="HOGENOM:HBG329099"
FT                   /db_xref="InterPro:IPR005033"
FT                   /db_xref="InterPro:IPR016665"
FT                   /db_xref="UniParc:UPI00003B7053"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJX8"
FT                   /transl_table=1
FT                   /translation="MVASTKRTIRIKTEQHILPDVPPVENFPVRQWSIEIALLDEEGKE
FT                   MPATIFDKVVYHLHPTFANPNRTFNEPPFKIVEQGWGGFPLDISLYFLEKGGERKISHD
FT                   LNFLQESYEVDHVIQVPLNKPTLTAELAKSGFTEDTSSGSKRKMTGSNTGAESKTKKAK
FT                   TTTASTIKGNVDLEKLAFGLTKLNEDDLVGVVQMVTDNKTPEMNVTNNVEEGEFIIDLY
FT                   SLPEGLLKSLWEYVKKNTE"
     MVASTKRTIR IKTEQHILPD VPPVENFPVR QWSIEIALLD EEGKEMPATI FDKVVYHLHP        60
     TFANPNRTFN EPPFKIVEQG WGGFPLDISL YFLEKGGERK ISHDLNFLQE SYEVDHVIQV       120
     PLNKPTLTAE LAKSGFTEDT SSGSKRKMTG SNTGAESKTK KAKTTTASTI KGNVDLEKLA       180
     FGLTKLNEDD LVGVVQMVTD NKTPEMNVTN NVEEGEFIID LYSLPEGLLK SLWEYVKKNT       240
     E                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page