(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE121

CAGLA1_12.PE121      Location/Qualifiers
FT   CDS             join(complement(321650..321739),complement(320283..320948))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000232073" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436742"
FT                   /gene_name="RPS0"
FT                   /locus_tag="CAGL0M02849g"
FT                   /product="40S ribosomal protein S0 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="CAG62446.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="HOGENOM:HBG481547"
FT                   /db_xref="HOGENOM:HBG736296"
FT                   /db_xref="HSSP:1VI6"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005707"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="UniParc:UPI00003B7057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJX4"
FT                   /transl_table=1
FT                   /translation="MSLPATFDLTPEDAQLLLAANTHLGARNVQVHQEPYVFNARPDGV
FT                   HVINVGKTWEKLVLAARIIAAIPNPEDVVAISSRTYGQRAVLKFAAHTGATPIAGRFTP
FT                   GSFTNYITRSFKEPRLVIVTDPRSDAQAIKEASYVNIPVIALTDLDSPSEYVDVAIPCN
FT                   NRGKHSIGLIWYLLAREVLRLRGALTDRTQPWSIMPDLYFYRNPEEIEQQTAEEAAQEA
FT                   GEEEAKEEVTEEQTEAAEWAQENADNVEW"
     MSLPATFDLT PEDAQLLLAA NTHLGARNVQ VHQEPYVFNA RPDGVHVINV GKTWEKLVLA        60
     ARIIAAIPNP EDVVAISSRT YGQRAVLKFA AHTGATPIAG RFTPGSFTNY ITRSFKEPRL       120
     VIVTDPRSDA QAIKEASYVN IPVIALTDLD SPSEYVDVAI PCNNRGKHSI GLIWYLLARE       180
     VLRLRGALTD RTQPWSIMPD LYFYRNPEEI EQQTAEEAAQ EAGEEEAKEE VTEEQTEAAE       240
     WAQENADNVE W                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page