(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE122

CAGLA1_12.PE122      Location/Qualifiers
FT   CDS             324009..325811
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000718" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436743"
FT                   /locus_tag="CAGL0M02871g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62447.1"
FT                   /db_xref="HOGENOM:HBG190107"
FT                   /db_xref="HOGENOM:HBG204123"
FT                   /db_xref="InterPro:IPR022751"
FT                   /db_xref="UniParc:UPI00003B7058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJX3"
FT                   /transl_table=1
FT                   /translation="MVSMRLLMNSLRKRKLLVAIQVVVLFLIFSHSFGTDYLIPYNSNT
FT                   EYASSAARVQPMQLPDPVAKKTLIGNVLRAALDAKPSPFKLDRDALKTSSCPKKGDVSS
FT                   GGIDQFHWTSAKNLKACLNLDDYAIKTLSEAHSRYMKTLFNDKGEFAISKSDFKKLYPN
FT                   EKGIVTLGGGRYTILAMLMIETVRRHGSTLPVEVMFPPEDEGEFDFCNNWLPKHNGRCV
FT                   MMSQEVPFEILQKDKEVRFKSYQIKSLALLLTSFKQFVFIDADNNAMKNIDHIFDTEAF
FT                   KTHGLILWPDLWKRFTNPGFYDIAGVKYDLGKRVRNVNDDASPPETYDPNHSIYTTHDL
FT                   KQREEIAKHLYEDVSLADLDGTIADTTTESGQMMVDNKKHLSTLLLALYYNIYGPDLYY
FT                   YMMSMGTAGEGDKETFISAAHVLHLPYYQVKTNIGFDGYVNDVDNQFKGVGLMQTDFEQ
FT                   DYQRHKQVLKELATEKPLEPVKYQLPNHFQDKMKNPDGTSLDIMFLHASFHKFDPADLA
FT                   KSKQYFKQNGEQVRGYNRIDAYKNFDFELFSFKKLYDNLCTSDHISFKSLKKHEGTEFW
FT                   TSMCSYFKQRVDFLTKTKPANAFI"
     MVSMRLLMNS LRKRKLLVAI QVVVLFLIFS HSFGTDYLIP YNSNTEYASS AARVQPMQLP        60
     DPVAKKTLIG NVLRAALDAK PSPFKLDRDA LKTSSCPKKG DVSSGGIDQF HWTSAKNLKA       120
     CLNLDDYAIK TLSEAHSRYM KTLFNDKGEF AISKSDFKKL YPNEKGIVTL GGGRYTILAM       180
     LMIETVRRHG STLPVEVMFP PEDEGEFDFC NNWLPKHNGR CVMMSQEVPF EILQKDKEVR       240
     FKSYQIKSLA LLLTSFKQFV FIDADNNAMK NIDHIFDTEA FKTHGLILWP DLWKRFTNPG       300
     FYDIAGVKYD LGKRVRNVND DASPPETYDP NHSIYTTHDL KQREEIAKHL YEDVSLADLD       360
     GTIADTTTES GQMMVDNKKH LSTLLLALYY NIYGPDLYYY MMSMGTAGEG DKETFISAAH       420
     VLHLPYYQVK TNIGFDGYVN DVDNQFKGVG LMQTDFEQDY QRHKQVLKEL ATEKPLEPVK       480
     YQLPNHFQDK MKNPDGTSLD IMFLHASFHK FDPADLAKSK QYFKQNGEQV RGYNRIDAYK       540
     NFDFELFSFK KLYDNLCTSD HISFKSLKKH EGTEFWTSMC SYFKQRVDFL TKTKPANAFI       600
//

If you have problems or comments...

PBIL Back to PBIL home page