(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE128

CAGLA1_12.PE128      Location/Qualifiers
FT   CDS             complement(337942..339618)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000174951" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500887"
FT                   /locus_tag="CAGL0M03003g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAG62453.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG176437"
FT                   /db_xref="HOGENOM:HBG325775"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B705E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJW7"
FT                   /transl_table=1
FT                   /translation="MVLIVTHNMTSEKNNPKSEKTNYDGVVTKSIAFDGCEECSSSDEC
FT                   QSNSDQLSVTSKGCICSVDDCHENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQT
FT                   QSLSTMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMT
FT                   LWSIICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIG
FT                   CMAPAGAALGALFGGLIVTEDAEQWPWVFYAFGIASFVNMLLALYSIPNNVPTNLNNLN
FT                   MDWIGSLLGVSGLLLLNIVWNQAPIVGWGEAYIIVLLIISIILLLIFVVYEIKYATSPL
FT                   LPPSVLENKKILMILAALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGT
FT                   VAAFVVALTIKKVGPAVLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDL
FT                   SFPASSIILSDFLPMQYQGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYR
FT                   SALYLAIGLASAGVCVSLVFLVTDIIAKRHRKRIESECESC"
     MVLIVTHNMT SEKNNPKSEK TNYDGVVTKS IAFDGCEECS SSDECQSNSD QLSVTSKGCI        60
     CSVDDCHEND SPFQNPEYFE TGFKEVMFII SCMVAQLLNQ AGQTQSLSTM NVLADYFKSN       120
     SSKQPWLMAS FPLVSGSFIL ISGRLGDIYG LKKALSVGYI IMTLWSIICG LAKYTNSDAF       180
     FIVCRSFQGL GIAFILPNIM GLVGNIYKVG TLRKNIVISC IGCMAPAGAA LGALFGGLIV       240
     TEDAEQWPWV FYAFGIASFV NMLLALYSIP NNVPTNLNNL NMDWIGSLLG VSGLLLLNIV       300
     WNQAPIVGWG EAYIIVLLII SIILLLIFVV YEIKYATSPL LPPSVLENKK ILMILAALFF       360
     GWGSFGIWTY YYYAFQLNLR KYTPLWAGGT HFMFVIWGTV AAFVVALTIK KVGPAVLLCF       420
     SMVAFDCGSI MLSVTPVHQT YWRMNVGMQI ILSFGMDLSF PASSIILSDF LPMQYQGMAG       480
     SLVNTVVNYS TSLCLGMGNT VEQQYNAHGA DLLKGYRSAL YLAIGLASAG VCVSLVFLVT       540
     DIIAKRHRKR IESECESC                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page