(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE129

CAGLA1_12.PE129      Location/Qualifiers
FT   CDS             complement(341849..345613)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111315" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436746"
FT                   /locus_tag="CAGL0M03025g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62454.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058307"
FT                   /db_xref="HOGENOM:HBG203520"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00003B705F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJW6"
FT                   /transl_table=1
FT                   /translation="MVSNADETFVAPRLIRVAGGGDDDVHGSGSGAGPANGNSVSGSNT
FT                   GSRGSTPTYRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGYTE
FT                   TLEERVRELETENKRLMALCNSDLGSNTRSDGLEKQSPSKRKRSPSMERDSERGFTENM
FT                   ELQLQQSCSSCGNSDPNHRCVHLKPVVSNIIVDSNTDVSFEQNVAPGLPAVKALNSMAE
FT                   REESAQLAMLVSLALPRSTEEILFIPQLMANIQKTFGFSSKQSLYTVSLLSSLKKNLPT
FT                   PNSNSSDENLSPNYYVSEDFRPFFYEVLKFDILGETETENGSNRNESPDSTIPNSRSDD
FT                   LLSWMEIQRLVDVYFECWSNTIPIFSRKLFIKQMKAFKTEVDKFGDRLFEVYKTEQIKI
FT                   NFLKIFATVLAVMCQMALLSRLKQLEATTQELECKRTQNLIAHYNQLIEKIHLDSFFQD
FT                   MSTTTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGST
FT                   MQKFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEEDSQLEGRVSDF
FT                   SLAVIRYAKVLGNILDSIFKRNMMSEAATESMAFVHEKALDIWKNRLPEKYGFRLEANG
FT                   LFNFDELTVVKNSEKDLIEKSSILLFYFLAKCMIHLPVIATRSASLEQQLQPGTSSDTS
FT                   ETPKESQNKTPTRVCPSYILMQKAASTMLQVMHYTSEYYLPSPINISRTKARFALLTAC
FT                   SAVEYLKGGSLYVETKNLLENLIIKLELERKLDLPGIISWHSLKLLDMALMLLLQSPTT
FT                   KMEKLDKLVQKKINHYNRQMGIPAMKLSNSRKNNKKIKLENESSQLSSTSNPIAKGELK
FT                   SDSVVCEEDDNVNDNEVTTTAKLEENNEFINPNKIEQGVTSNTLAFSFSSTDLSALFNA
FT                   PESLFKVPNENTQYNQQHEMHNNSISSSHSKEPVNKERDSDKQELNAIFNETQNRSTSF
FT                   AKLMLLLNNEHKSLSSSLENDVRNVGNKLSSENAGQLPSHGATSGLNSKGNEFLSMNTL
FT                   YGGDNDFIIDASLGLAPLLSENNEIHRQHEGTQVQAGNNDILSTRIGFNGKDDYSNSRS
FT                   FTNEMFGGSDTKRTRSDTTALLTANSELTHDSQDGNVNFGSTNSELHERLNNNHFDAAT
FT                   SYLPEQKSEYGSSFGNKNTVKSLSPSTSFLDDDTLSLSFGDYSTQRRPRRYPNYNNTLG
FT                   KDSLAMKTEINGGRNQGNLHDLFQWQNSK"
     MVSNADETFV APRLIRVAGG GDDDVHGSGS GAGPANGNSV SGSNTGSRGS TPTYRVAQAC        60
     DRCRLKKTKC DGKIPQCSQC ALVGFECKIS DRLNRKSFPR GYTETLEERV RELETENKRL       120
     MALCNSDLGS NTRSDGLEKQ SPSKRKRSPS MERDSERGFT ENMELQLQQS CSSCGNSDPN       180
     HRCVHLKPVV SNIIVDSNTD VSFEQNVAPG LPAVKALNSM AEREESAQLA MLVSLALPRS       240
     TEEILFIPQL MANIQKTFGF SSKQSLYTVS LLSSLKKNLP TPNSNSSDEN LSPNYYVSED       300
     FRPFFYEVLK FDILGETETE NGSNRNESPD STIPNSRSDD LLSWMEIQRL VDVYFECWSN       360
     TIPIFSRKLF IKQMKAFKTE VDKFGDRLFE VYKTEQIKIN FLKIFATVLA VMCQMALLSR       420
     LKQLEATTQE LECKRTQNLI AHYNQLIEKI HLDSFFQDMS TTTVQSLQLL SFISFYFLNV       480
     GDIPRLYQLR GTVISMAQQL RLHRCPSAVL LSASGSTMQK FEQGERRLLF WAIYYLDVFY       540
     SLQLGVPRLI KDHEIECALP VSEEEDSQLE GRVSDFSLAV IRYAKVLGNI LDSIFKRNMM       600
     SEAATESMAF VHEKALDIWK NRLPEKYGFR LEANGLFNFD ELTVVKNSEK DLIEKSSILL       660
     FYFLAKCMIH LPVIATRSAS LEQQLQPGTS SDTSETPKES QNKTPTRVCP SYILMQKAAS       720
     TMLQVMHYTS EYYLPSPINI SRTKARFALL TACSAVEYLK GGSLYVETKN LLENLIIKLE       780
     LERKLDLPGI ISWHSLKLLD MALMLLLQSP TTKMEKLDKL VQKKINHYNR QMGIPAMKLS       840
     NSRKNNKKIK LENESSQLSS TSNPIAKGEL KSDSVVCEED DNVNDNEVTT TAKLEENNEF       900
     INPNKIEQGV TSNTLAFSFS STDLSALFNA PESLFKVPNE NTQYNQQHEM HNNSISSSHS       960
     KEPVNKERDS DKQELNAIFN ETQNRSTSFA KLMLLLNNEH KSLSSSLEND VRNVGNKLSS      1020
     ENAGQLPSHG ATSGLNSKGN EFLSMNTLYG GDNDFIIDAS LGLAPLLSEN NEIHRQHEGT      1080
     QVQAGNNDIL STRIGFNGKD DYSNSRSFTN EMFGGSDTKR TRSDTTALLT ANSELTHDSQ      1140
     DGNVNFGSTN SELHERLNNN HFDAATSYLP EQKSEYGSSF GNKNTVKSLS PSTSFLDDDT      1200
     LSLSFGDYST QRRPRRYPNY NNTLGKDSLA MKTEINGGRN QGNLHDLFQW QNSK            1254
//

If you have problems or comments...

PBIL Back to PBIL home page