(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE130

CAGLA1_12.PE130      Location/Qualifiers
FT   CDS             346435..347349
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176611" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436747"
FT                   /locus_tag="CAGL0M03047g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62455.1"
FT                   /db_xref="HOGENOM:HBG191816"
FT                   /db_xref="HOGENOM:HBG627717"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="UniParc:UPI00003B7060"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJW5"
FT                   /transl_table=1
FT                   /translation="MLKRPNTPTMKSIRNFPFSKLLFKLTKLTIIFQVLYIYFTPKVED
FT                   LNKENLTKLLPTHDNFGVLNLVIAHPDDEIMFFSPTILQLIDHVQELNVVCLSNGDADG
FT                   LGELRAKELKDAIGYLTVNRNLRNVSLNILDYTDGQNEVWSGVATDLKKYILTSEPGVK
FT                   QKDIILTFDREGISGHRNHIACNEGVISYLKTIKSNSFVFLELKSLSTWQIISKYSGVV
FT                   PKLLEIIYNKIRASNKTFVSYLPNRDSIATDSNVCFISTFDQYALSFAAMCYAHKSQMV
FT                   WFRYLWWSFSRYVFVNDLSRITV"
     MLKRPNTPTM KSIRNFPFSK LLFKLTKLTI IFQVLYIYFT PKVEDLNKEN LTKLLPTHDN        60
     FGVLNLVIAH PDDEIMFFSP TILQLIDHVQ ELNVVCLSNG DADGLGELRA KELKDAIGYL       120
     TVNRNLRNVS LNILDYTDGQ NEVWSGVATD LKKYILTSEP GVKQKDIILT FDREGISGHR       180
     NHIACNEGVI SYLKTIKSNS FVFLELKSLS TWQIISKYSG VVPKLLEIIY NKIRASNKTF       240
     VSYLPNRDSI ATDSNVCFIS TFDQYALSFA AMCYAHKSQM VWFRYLWWSF SRYVFVNDLS       300
     RITV                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page