(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE131

CAGLA1_12.PE131      Location/Qualifiers
FT   CDS             complement(347584..349230)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348729"
FT                   /locus_tag="CAGL0M03069g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62456.1"
FT                   /db_xref="HOGENOM:HBG124034"
FT                   /db_xref="UniParc:UPI00003B7061"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJW4"
FT                   /transl_table=1
FT                   /translation="MRKQVIGINNIFHLARIRSIPVHCHCKGPLYSYPVVSKTLFHTKN
FT                   VEVSKYSHVELRSLNEQIHSQLTSLTDLNKRQLLLVETLSRNNNLEKLLDYYEIDEGSV
FT                   EDAIQLLQDSNVSIQEFSSMIQPVLNRTNLVGKYHMGYLSKLMQIYISLTRTHNGGSVD
FT                   ALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGEDLLGPYGDKQTIAHFLMLRS
FT                   GALQDLWKIDVSNGNNKKQAFYKINGSHRNVKSTYNVLDSVKLFEIVRYILRYNDKDNH
FT                   SQPVYFDEGILKNVILCLGYVGQTTLIEDIINKIWELDSVSVPPKYNITVTSDLLTAIV
FT                   SAYSKCGKSIQPGLVIADKFFGKIPNIIVKDDFWINLQKWNIILPNKWRSTIDLSKRTW
FT                   ELMKSWRNSTNNGGFITANVEFLNLVYKVLSSDYIKLKDLEWIYDIFQHSLVTLYSKNS
FT                   LTVDEIKLLKKFQIFTIKKMVYFGHYSKCLQFIKEWSYDAANKQQLTNLFVVLRNRYLQ
FT                   KRGYNQEKEMTKVQKKYDEEEQEDMLLGGLW"
     MRKQVIGINN IFHLARIRSI PVHCHCKGPL YSYPVVSKTL FHTKNVEVSK YSHVELRSLN        60
     EQIHSQLTSL TDLNKRQLLL VETLSRNNNL EKLLDYYEID EGSVEDAIQL LQDSNVSIQE       120
     FSSMIQPVLN RTNLVGKYHM GYLSKLMQIY ISLTRTHNGG SVDALNKDDM NKFIKRFIEG       180
     SQLKRAQTAL QFLLDGYKER GEDLLGPYGD KQTIAHFLML RSGALQDLWK IDVSNGNNKK       240
     QAFYKINGSH RNVKSTYNVL DSVKLFEIVR YILRYNDKDN HSQPVYFDEG ILKNVILCLG       300
     YVGQTTLIED IINKIWELDS VSVPPKYNIT VTSDLLTAIV SAYSKCGKSI QPGLVIADKF       360
     FGKIPNIIVK DDFWINLQKW NIILPNKWRS TIDLSKRTWE LMKSWRNSTN NGGFITANVE       420
     FLNLVYKVLS SDYIKLKDLE WIYDIFQHSL VTLYSKNSLT VDEIKLLKKF QIFTIKKMVY       480
     FGHYSKCLQF IKEWSYDAAN KQQLTNLFVV LRNRYLQKRG YNQEKEMTKV QKKYDEEEQE       540
     DMLLGGLW                                                                548
//

If you have problems or comments...

PBIL Back to PBIL home page