(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE133

CAGLA1_12.PE133      Location/Qualifiers
FT   CDS             352552..354423
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000807" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044352"
FT                   /gene_name="EXO70"
FT                   /locus_tag="CAGL0M03113g"
FT                   /product="Exocyst complex protein EXO70 "
FT                   /biological_process="exocytosis"
FT                   /biological_process="protein transport"
FT                   /cellular_component="cellular bud neck"
FT                   /cellular_component="exocyst"
FT                   /protein_id="CAG62458.1"
FT                   /db_xref="GO:0000145"
FT                   /db_xref="GO:0005935"
FT                   /db_xref="GO:0006887"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG059390"
FT                   /db_xref="HOGENOM:HBG202183"
FT                   /db_xref="InterPro:IPR004140"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="UniParc:UPI00003B7063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJW2"
FT                   /transl_table=1
FT                   /translation="MNEIDVDEADILVLSQGLEKTSRLTHQVNKSLAKISKTSAQSSQL
FT                   FGPILARNNVLKTLQRNIDSTLNSVASVKDLANEASKHEVLLRKGIASLGLKPFTVELH
FT                   KLEDMYQDMSVGNSRHTENAEFHGILKHLKEMITSSEEQLELEFIQILKRIEPFDPQIN
FT                   MEKKIPFPYYSDEDISQMLIIFNYFYVKSEDSRMQDIFIRERGDQMLKSMAFMEPFAKK
FT                   VTSSKNAPYEKGSSGFINYTEAVLGFIANERSLIDDVFSQFAEIKPRVLRNILDPIVAA
FT                   FCKVLMSDLIFVKSNIDNAGLFSFELTECISGVQKSVKGMNLKNQMQLIDADKQVKDVT
FT                   RSLFKDTVDRIKSKTNQMTTIPSDNGVTEATVDTMSRLRKFSEYKTGCLAAMESISRDV
FT                   WLSKSFREKEYTIQSAAIADNETAASLLSCFLSDCIDTLVANLERRAQTILMPNQEPDV
FT                   ANPNSARNKFKQRIGFLVLMNMTLVEQIVEKSELSVMLGNLGKARIEKLKKRYVNYLVA
FT                   DWKDLTVNLMDTVVIDSVGKKSKDKEQIKEKFRRFNEGFEDLISRTKQYKLSDPALKRL
FT                   LKSEIVALLMPMYDRFYGRYKDSFKNPRKHIKYTPDDITNVISQTLR"
     MNEIDVDEAD ILVLSQGLEK TSRLTHQVNK SLAKISKTSA QSSQLFGPIL ARNNVLKTLQ        60
     RNIDSTLNSV ASVKDLANEA SKHEVLLRKG IASLGLKPFT VELHKLEDMY QDMSVGNSRH       120
     TENAEFHGIL KHLKEMITSS EEQLELEFIQ ILKRIEPFDP QINMEKKIPF PYYSDEDISQ       180
     MLIIFNYFYV KSEDSRMQDI FIRERGDQML KSMAFMEPFA KKVTSSKNAP YEKGSSGFIN       240
     YTEAVLGFIA NERSLIDDVF SQFAEIKPRV LRNILDPIVA AFCKVLMSDL IFVKSNIDNA       300
     GLFSFELTEC ISGVQKSVKG MNLKNQMQLI DADKQVKDVT RSLFKDTVDR IKSKTNQMTT       360
     IPSDNGVTEA TVDTMSRLRK FSEYKTGCLA AMESISRDVW LSKSFREKEY TIQSAAIADN       420
     ETAASLLSCF LSDCIDTLVA NLERRAQTIL MPNQEPDVAN PNSARNKFKQ RIGFLVLMNM       480
     TLVEQIVEKS ELSVMLGNLG KARIEKLKKR YVNYLVADWK DLTVNLMDTV VIDSVGKKSK       540
     DKEQIKEKFR RFNEGFEDLI SRTKQYKLSD PALKRLLKSE IVALLMPMYD RFYGRYKDSF       600
     KNPRKHIKYT PDDITNVISQ TLR                                               623
//

If you have problems or comments...

PBIL Back to PBIL home page