(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE134

CAGLA1_12.PE134      Location/Qualifiers
FT   CDS             complement(354638..357859)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141755" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436749"
FT                   /locus_tag="CAGL0M03135g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62459.1"
FT                   /db_xref="HOGENOM:HBG189670"
FT                   /db_xref="HOGENOM:HBG202366"
FT                   /db_xref="InterPro:IPR011021"
FT                   /db_xref="InterPro:IPR011022"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniParc:UPI00003B7064"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJW1"
FT                   /transl_table=1
FT                   /translation="MPIADSNSPLFPIGKDLTIPTDAKPVASTASVQIYIKLAEPVVFL
FT                   QDFENLNHSDKPPGILRGSLILRILKPTKVKNLTLNFKGYARTEWIEGIPPKKQEFAEI
FT                   NDIINHTWPFYQSSEHHHSHHAHSSTASSSPAASNATSNNSGSNTRTGTPGNEDSPVYK
FT                   GTGAALYRPLPRSTSERALRTGATQSSTPTNFSPLKNNTVLRSKSKDNLDDFARKRVLS
FT                   RASSHSTLTNNSFNSSSNNNNGHTLNKTLSPMSFLRRATSSNSAHAFGVNDTPSASHRN
FT                   GASTPTHPAPTGSFISDILSGNFASPGDSTTHNHAGNSSHQVNSNNQSQQATADFDPVG
FT                   ENGTFQPGDYIYPFEQLIPQSYPETVKAEFGFVEYYLFVSLERHGPFKSNLTGRTPVNI
FT                   IRTQSDNSVEESEPIIISRDWENALFYDIVIGSKDIVLDAFLPINFRLSPMEKLTLHRI
FT                   RIYVTETMEYFCKNQKVHRIEPTKKFLLAEHKGPRVPGLPKDANYNKAKNMGNLLLDES
FT                   SGDLVNKEFQYQLFVPSKFNNHQKIHPDTTYDNIKANHWIKICLRLSRVVGDKRKHYEI
FT                   SIDSPMRVLHKLCSHANTLLPSYESHLIFNKQNFTDSSSQKNRESTNDNELGLYHDSNI
FT                   FFPKEVLMSPLLSPDVQALDVNTESIYNAPYRVIRHDEFDDSRHKSGNDPSANVFNSPT
FT                   LKSNIYQPDSIQRELASPQAVPLSPMLSSLSLTDFHQSNPPDFESLEDQLSAATTRSNS
FT                   PMILPKDPPTYKEATHNDPSGVVASASIPKIKLSHSQESLPINNKNLRIKGLTPFSDTA
FT                   SIDTLSNDSDIAAGFQFSSSPNLTHSLLRSHSPSMISLHTGENVKNTPRLDVSHDNMPS
FT                   TIRDDRHFFNDISQILGDEAEENENHLKLSRTHESSNGEASARSSFDMSAINFRKDSVT
FT                   AEPLLSNRNNSQISGIGNFAMPSKESLPLLGSPTDSSVDITALYDRNSAAWHPLQLEGE
FT                   IPLSPIVSNESHSNMLFKANQRPNDDATNTSHDDMLTRDVNPTDDSSGGLSDTDHRRTS
FT                   HIGEHEKPITNAAETHKNINAVDSI"
     MPIADSNSPL FPIGKDLTIP TDAKPVASTA SVQIYIKLAE PVVFLQDFEN LNHSDKPPGI        60
     LRGSLILRIL KPTKVKNLTL NFKGYARTEW IEGIPPKKQE FAEINDIINH TWPFYQSSEH       120
     HHSHHAHSST ASSSPAASNA TSNNSGSNTR TGTPGNEDSP VYKGTGAALY RPLPRSTSER       180
     ALRTGATQSS TPTNFSPLKN NTVLRSKSKD NLDDFARKRV LSRASSHSTL TNNSFNSSSN       240
     NNNGHTLNKT LSPMSFLRRA TSSNSAHAFG VNDTPSASHR NGASTPTHPA PTGSFISDIL       300
     SGNFASPGDS TTHNHAGNSS HQVNSNNQSQ QATADFDPVG ENGTFQPGDY IYPFEQLIPQ       360
     SYPETVKAEF GFVEYYLFVS LERHGPFKSN LTGRTPVNII RTQSDNSVEE SEPIIISRDW       420
     ENALFYDIVI GSKDIVLDAF LPINFRLSPM EKLTLHRIRI YVTETMEYFC KNQKVHRIEP       480
     TKKFLLAEHK GPRVPGLPKD ANYNKAKNMG NLLLDESSGD LVNKEFQYQL FVPSKFNNHQ       540
     KIHPDTTYDN IKANHWIKIC LRLSRVVGDK RKHYEISIDS PMRVLHKLCS HANTLLPSYE       600
     SHLIFNKQNF TDSSSQKNRE STNDNELGLY HDSNIFFPKE VLMSPLLSPD VQALDVNTES       660
     IYNAPYRVIR HDEFDDSRHK SGNDPSANVF NSPTLKSNIY QPDSIQRELA SPQAVPLSPM       720
     LSSLSLTDFH QSNPPDFESL EDQLSAATTR SNSPMILPKD PPTYKEATHN DPSGVVASAS       780
     IPKIKLSHSQ ESLPINNKNL RIKGLTPFSD TASIDTLSND SDIAAGFQFS SSPNLTHSLL       840
     RSHSPSMISL HTGENVKNTP RLDVSHDNMP STIRDDRHFF NDISQILGDE AEENENHLKL       900
     SRTHESSNGE ASARSSFDMS AINFRKDSVT AEPLLSNRNN SQISGIGNFA MPSKESLPLL       960
     GSPTDSSVDI TALYDRNSAA WHPLQLEGEI PLSPIVSNES HSNMLFKANQ RPNDDATNTS      1020
     HDDMLTRDVN PTDDSSGGLS DTDHRRTSHI GEHEKPITNA AETHKNINAV DSI             1073
//

If you have problems or comments...

PBIL Back to PBIL home page