(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE135

CAGLA1_12.PE135      Location/Qualifiers
FT   CDS             358599..361211
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437832"
FT                   /gene_name="IRS4"
FT                   /locus_tag="CAGL0M03157g"
FT                   /product="Increased rDNA silencing protein 4 "
FT                   /function="calcium ion binding"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAG62460.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="HOGENOM:HBG124035"
FT                   /db_xref="HSSP:1EH2"
FT                   /db_xref="InterPro:IPR000261"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniParc:UPI00003B7065"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJW0"
FT                   /transl_table=1
FT                   /translation="MHMRLNKRRRNHVQEQMSELPQDAKNDSLAAAQVIFKRHADNANS
FT                   TPPSPVGLDSAGHLDKQADTAQRVHKVGTPSGTSSSHNSGNEGMHKVTKPLGENTATTA
FT                   PIAIKQPVRVVRASPTAIVSPTSHTPLDAATAAANVVAEKSKIRTTQQQLQDKKRRDIE
FT                   NAHHAASAAAVTSSNLAVGSPPSQYIPSVPTLNVTSPQMRNSSQNIDRRSKSNEEAHNG
FT                   HEKMMNSRSNSINSSTIKGSVSEPNTVTPLRQNSPSNMDDIIQKMEAVDIDEGRKNSFV
FT                   MNGSGDSVDSLKPNVVRRPMRTPSGRRVRPPSPIDKIGSIQEPHLESTGFNDQNDFSEM
FT                   SSLIDGSSSEDITKIRGSGIRERSPVDGVEHGGMSVNIPMQRSLSSDVLSPSQQAAMVA
FT                   ATKLSPSTQTLPVEELEYLASTGDVSAYKALNKINGTNMAYKGTIPDLIPSRARAQKTS
FT                   KLKFKIFGGGKNSDRRNNATPIGYDPVMNISTDFGGKKVVESNQNNVKFKTTMRSQKYL
FT                   GNDNLDDNDLRTQYIDDDDDDDDYDSAYEDLDYSRDDSEAMYKGDRESSNPRSNSLLQS
FT                   SSYSGKVGFNSNANSGTSINNSGNVSNLDYSLRDGVAEKKKSRRDKIKKKLKSTASVVP
FT                   YYPHYALTHLASGVSTVNSNLNNSNKNTKWFNEDKPWKSHKDVGFVTSQERKRYEAMWV
FT                   TNRYLYLNLLPWWPKEEVEKDEDDSASNLNSNASTNVGGVLSDGDNEEDDVTRFLLSLP
FT                   ADGLMLNLVAKDIWERSNLPNDLLKQIYDLVDTRKDGTLNRESFLVGMWLVDQCLYGRK
FT                   LPQELDPKIWDSVDRWVLNVVNSTMMTALERKQKKKMMKKELKNIKREQKQAIAEQHN"
     MHMRLNKRRR NHVQEQMSEL PQDAKNDSLA AAQVIFKRHA DNANSTPPSP VGLDSAGHLD        60
     KQADTAQRVH KVGTPSGTSS SHNSGNEGMH KVTKPLGENT ATTAPIAIKQ PVRVVRASPT       120
     AIVSPTSHTP LDAATAAANV VAEKSKIRTT QQQLQDKKRR DIENAHHAAS AAAVTSSNLA       180
     VGSPPSQYIP SVPTLNVTSP QMRNSSQNID RRSKSNEEAH NGHEKMMNSR SNSINSSTIK       240
     GSVSEPNTVT PLRQNSPSNM DDIIQKMEAV DIDEGRKNSF VMNGSGDSVD SLKPNVVRRP       300
     MRTPSGRRVR PPSPIDKIGS IQEPHLESTG FNDQNDFSEM SSLIDGSSSE DITKIRGSGI       360
     RERSPVDGVE HGGMSVNIPM QRSLSSDVLS PSQQAAMVAA TKLSPSTQTL PVEELEYLAS       420
     TGDVSAYKAL NKINGTNMAY KGTIPDLIPS RARAQKTSKL KFKIFGGGKN SDRRNNATPI       480
     GYDPVMNIST DFGGKKVVES NQNNVKFKTT MRSQKYLGND NLDDNDLRTQ YIDDDDDDDD       540
     YDSAYEDLDY SRDDSEAMYK GDRESSNPRS NSLLQSSSYS GKVGFNSNAN SGTSINNSGN       600
     VSNLDYSLRD GVAEKKKSRR DKIKKKLKST ASVVPYYPHY ALTHLASGVS TVNSNLNNSN       660
     KNTKWFNEDK PWKSHKDVGF VTSQERKRYE AMWVTNRYLY LNLLPWWPKE EVEKDEDDSA       720
     SNLNSNASTN VGGVLSDGDN EEDDVTRFLL SLPADGLMLN LVAKDIWERS NLPNDLLKQI       780
     YDLVDTRKDG TLNRESFLVG MWLVDQCLYG RKLPQELDPK IWDSVDRWVL NVVNSTMMTA       840
     LERKQKKKMM KKELKNIKRE QKQAIAEQHN                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page