(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE136

CAGLA1_12.PE136      Location/Qualifiers
FT   CDS             362253..364484
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000066085" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437833"
FT                   /gene_name="IML2"
FT                   /locus_tag="CAGL0M03179g"
FT                   /product="Mitochondrial outer membrane protein IML2 "
FT                   /function="binding"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="CAG62461.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG124036"
FT                   /db_xref="HOGENOM:HBG395662"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR019412"
FT                   /db_xref="UniParc:UPI00003B7066"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJV9"
FT                   /transl_table=1
FT                   /translation="MFKVFGALSGKGSSDSNGNSTRSSINEKRTKLILKEANDFEIALR
FT                   AMDYVLDDRTEEGLALLRENEKVNGQNQTITVLARGVIEFLQATLSFEMEEIKNASNTL
FT                   AKAEQLSWKSRTEAQKSGIRNSSIYPPGTVYAVTYTESCLLHALLMLFTESMMDAAKAL
FT                   LKLRKAYSMLHEIMEVVKKSELSRKVSSSSAVSIQSNGSFVSEEATFVSADIPYQLSET
FT                   ESNDPELWAFAEKIYKMRKLRLSGAHIGNTPAISRLRSGLGLSASNKSEELANSEQSVL
FT                   SDEAAERQATIDEFIHSGVNLCYGILQVVLSLIPPAIGAVLSIVGFRGSREEGLRLIWK
FT                   ATKDRNVHGCIGLLGLMFYYDGPFQFTDVDFDIPPALSNTKTSDSDTDRDGSISIDEMD
FT                   GHALLHPGPILEEALLHARALFPNSALWLLNEARMLSSRGRLPEAIELLDSIDVESIHM
FT                   RQVKGLLVFDKAITLVHMQEYERAATNLLSLLKISDWSHAFYTYFAGCCYLENWRMAQM
FT                   GFIKDDKLEFYREKAEELIFSAPKLLGKKTFKSKNLPLDRFMLRKVEQFKATQKKLGVK
FT                   NILDAIGTSPIREITYFYNGYNRMSKSDLEIAQKMLTSYHNPAIDQHDPDQELIKNLLL
FT                   SLTMRRLGDVESGVKLLDEKVLPSIYYMQNGKVKYIKKTEDPWAYPTALYERALFTWKL
FT                   DGVDNLSECRHWLVTAQNYAGDYELSTRVGMKIKAALDRVEESLQHGTA"
     MFKVFGALSG KGSSDSNGNS TRSSINEKRT KLILKEANDF EIALRAMDYV LDDRTEEGLA        60
     LLRENEKVNG QNQTITVLAR GVIEFLQATL SFEMEEIKNA SNTLAKAEQL SWKSRTEAQK       120
     SGIRNSSIYP PGTVYAVTYT ESCLLHALLM LFTESMMDAA KALLKLRKAY SMLHEIMEVV       180
     KKSELSRKVS SSSAVSIQSN GSFVSEEATF VSADIPYQLS ETESNDPELW AFAEKIYKMR       240
     KLRLSGAHIG NTPAISRLRS GLGLSASNKS EELANSEQSV LSDEAAERQA TIDEFIHSGV       300
     NLCYGILQVV LSLIPPAIGA VLSIVGFRGS REEGLRLIWK ATKDRNVHGC IGLLGLMFYY       360
     DGPFQFTDVD FDIPPALSNT KTSDSDTDRD GSISIDEMDG HALLHPGPIL EEALLHARAL       420
     FPNSALWLLN EARMLSSRGR LPEAIELLDS IDVESIHMRQ VKGLLVFDKA ITLVHMQEYE       480
     RAATNLLSLL KISDWSHAFY TYFAGCCYLE NWRMAQMGFI KDDKLEFYRE KAEELIFSAP       540
     KLLGKKTFKS KNLPLDRFML RKVEQFKATQ KKLGVKNILD AIGTSPIREI TYFYNGYNRM       600
     SKSDLEIAQK MLTSYHNPAI DQHDPDQELI KNLLLSLTMR RLGDVESGVK LLDEKVLPSI       660
     YYMQNGKVKY IKKTEDPWAY PTALYERALF TWKLDGVDNL SECRHWLVTA QNYAGDYELS       720
     TRVGMKIKAA LDRVEESLQH GTA                                               743
//

If you have problems or comments...

PBIL Back to PBIL home page