(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE137

CAGLA1_12.PE137      Location/Qualifiers
FT   CDS             complement(364771..366252)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233340" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348982"
FT                   /gene_name="ARP4"
FT                   /locus_tag="CAGL0M03201g"
FT                   /product="Actin-related protein 4 "
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62462.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG345785"
FT                   /db_xref="HOGENOM:HBG559892"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="UniParc:UPI00003B7067"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJV8"
FT                   /transl_table=1
FT                   /translation="MSNSALQVYGGDEITAVIIDPGSYTTNIGYAGTDCPQSILPSSFG
FT                   EIHEAEESTSEDNTEKTRKTRKVFSEQSIPIPRPDYEVKRVVENGQVCDWDSAVEQWSW
FT                   ALRNELHIESNRGIPAMLTEPLWNSKENRSKSLEILLEGMEFEACYLTATSTAVSFATG
FT                   RPNSLIVDIGHDIASVTPVIDGMSLSKSTRCNHFAGRFLNKLLTDYLKPREIIPLFEVE
FT                   QRKPEFKRRSFSYSVADSLYDYANSRGFFQECKETIFQVATTPIAQEKNNQATSTGRTI
FT                   ESPWNEVIEFESNDRYQFAEQLINPLKESVPDDWPVNVAGVVETWRNDYVPMKRNKVGS
FT                   GNNKEKEGTKESTPLDSNTATPLPESSSTTNENGKRTAEDIKREELPGIVDLISSSISS
FT                   CDVDIRASLAHNLVITGGSSTIPGLSDRILNELNMKFPALKFRVLATGQSIERQYQSWL
FT                   GGSILSSLGTFHQLWIGKKEYEEVGSERLLHDRLR"
     MSNSALQVYG GDEITAVIID PGSYTTNIGY AGTDCPQSIL PSSFGEIHEA EESTSEDNTE        60
     KTRKTRKVFS EQSIPIPRPD YEVKRVVENG QVCDWDSAVE QWSWALRNEL HIESNRGIPA       120
     MLTEPLWNSK ENRSKSLEIL LEGMEFEACY LTATSTAVSF ATGRPNSLIV DIGHDIASVT       180
     PVIDGMSLSK STRCNHFAGR FLNKLLTDYL KPREIIPLFE VEQRKPEFKR RSFSYSVADS       240
     LYDYANSRGF FQECKETIFQ VATTPIAQEK NNQATSTGRT IESPWNEVIE FESNDRYQFA       300
     EQLINPLKES VPDDWPVNVA GVVETWRNDY VPMKRNKVGS GNNKEKEGTK ESTPLDSNTA       360
     TPLPESSSTT NENGKRTAED IKREELPGIV DLISSSISSC DVDIRASLAH NLVITGGSST       420
     IPGLSDRILN ELNMKFPALK FRVLATGQSI ERQYQSWLGG SILSSLGTFH QLWIGKKEYE       480
     EVGSERLLHD RLR                                                          493
//

If you have problems or comments...

PBIL Back to PBIL home page